| UniProt ID | NFYA_HUMAN | |
|---|---|---|
| UniProt AC | P23511 | |
| Protein Name | Nuclear transcription factor Y subunit alpha | |
| Gene Name | NFYA | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 347 | |
| Subcellular Localization | Nucleus. | |
| Protein Description | Component of the sequence-specific heterotrimeric transcription factor (NF-Y) which specifically recognizes a 5'-CCAAT-3' box motif found in the promoters of its target genes. NF-Y can function as both an activator and a repressor, depending on its interacting cofactors. NF-YA positively regulates the transcription of the core clock component ARNTL/BMAL1.. | |
| Protein Sequence | MEQYTANSNSSTEQIVVQAGQIQQQQQGGVTAVQLQTEAQVASASGQQVQTLQVVQGQPLMVQVSGGQLITSTGQPIMVQAVPGGQGQTIMQVPVSGTQGLQQIQLVPPGQIQIQGGQAVQVQGQQGQTQQIIIQQPQTAVTAGQTQTQQQIAVQGQQVAQTAEGQTIVYQPVNADGTILQQVTVPVSGMITIPAASLAGAQIVQTGANTNTTSSGQGTVTVTLPVAGNVVNSGGMVMMVPGAGSVPAIQRIPLPGAEMLEEEPLYVNAKQYHRILKRRQARAKLEAEGKIPKERRKYLHESRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQADEEAMTQIIRVS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 184 | O-linked_Glycosylation | GTILQQVTVPVSGMI CCEEEEEEEECCCCE | 18.11 | 23301498 | |
| 188 | O-linked_Glycosylation | QQVTVPVSGMITIPA EEEEEECCCCEEEEH | 19.30 | 23301498 | |
| 192 | O-linked_Glycosylation | VPVSGMITIPAASLA EECCCCEEEEHHHHC | 16.41 | 23301498 | |
| 197 | O-linked_Glycosylation | MITIPAASLAGAQIV CEEEEHHHHCCCEEE | 22.36 | 23301498 | |
| 266 | Phosphorylation | MLEEEPLYVNAKQYH HHCCCCCCCCHHHHH | 11.45 | 28674151 | |
| 270 | Ubiquitination | EPLYVNAKQYHRILK CCCCCCHHHHHHHHH | 46.30 | - | |
| 290 | Acetylation | AKLEAEGKIPKERRK HHHHHCCCCCHHHHH | 47.54 | 25953088 | |
| 302 | Phosphorylation | RRKYLHESRHRHAMA HHHHHHHHHHHHHHH | 23.73 | 24719451 | |
| 317 | Methylation | RKRGEGGRFFSPKEK HHCCCCCCCCCCCCC | 40.05 | 115484961 | |
| 320 | Phosphorylation | GEGGRFFSPKEKDSP CCCCCCCCCCCCCCC | 32.14 | 29496963 | |
| 322 | Ubiquitination | GGRFFSPKEKDSPHM CCCCCCCCCCCCCCC | 75.97 | - | |
| 324 | Acetylation | RFFSPKEKDSPHMQD CCCCCCCCCCCCCCC | 70.41 | 25953088 | |
| 326 | Phosphorylation | FSPKEKDSPHMQDPN CCCCCCCCCCCCCCC | 27.98 | 29255136 | |
| 341 | Phosphorylation | QADEEAMTQIIRVS- HHCHHHHHHHHCCC- | 24.54 | 23403867 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NFYA_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NFYA_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NFYA_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A quantitative atlas of mitotic phosphorylation."; Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-326, AND MASSSPECTROMETRY. | |
