| UniProt ID | TCAF1_HUMAN | |
|---|---|---|
| UniProt AC | Q9Y4C2 | |
| Protein Name | TRPM8 channel-associated factor 1 {ECO:0000303|PubMed:25559186} | |
| Gene Name | TCAF1 {ECO:0000303|PubMed:25559186, ECO:0000312|HGNC:HGNC:22201} | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 921 | |
| Subcellular Localization | Cell membrane . Colocalizes with TRPM8 on the plasma membrane. | |
| Protein Description | Positively regulates the plasma membrane cation channel TRPM8 activity. Involved in the recruitment of TRPM8 to the cell surface. Promotes prostate cancer cell migration inhibition in a TRPM8-dependent manner.. | |
| Protein Sequence | MATPSAAFEALMNGVTSWDVPEDAVPCELLLIGEASFPVMVNDMGQVLIAASSYGRGRLVVVSHEDYLVEAQLTPFLLNAVGWLCSSPGAPIGVHPSLAPLAKILEGSGVDAKVEPEVKDSLGVYCIDAYNETMTEKLVKFMKCGGGLLIGGQAWDWANQGEDERVLFTFPGNLVTSVAGIYFTDNKGDTSFFKVSKKMPKIPVLVSCEDDLSDDREELLHGISELDISNSDCFPSQLLVHGALAFPLGLDSYHGCVIAAARYGRGRVVVTGHKVLFTVGKLGPFLLNAVRWLDGGRRGKVVVQTELRTLSGLLAVGGIDTSIEPNLTSDASVYCFEPVSEVGVKELQEFVAEGGGLFVGAQAWWWAFKNPGVSPLARFPGNLLLNPFGISITSQSLNPGPFRTPKAGIRTYHFRSTLAEFQVIMGRKRGNVEKGWLAKLGPDGAAFLQIPAEEIPAYMSVHRLLRKLLSRYRLPVATRENPVINDCCRGAMLSLATGLAHSGSDLSLLVPEIEDMYSSPYLRPSESPITVEVNCTNPGTRYCWMSTGLYIPGRQIIEVSLPEAAASADLKIQIGCHTDDLTRASKLFRGPLVINRCCLDKPTKSITCLWGGLLYIIVPQNSKLGSVPVTVKGAVHAPYYKLGETTLEEWKRRIQENPGPWGELATDNIILTVPTANLRTLENPEPLLRLWDEVMQAVARLGAEPFPLRLPQRIVADVQISVGWMHAGYPIMCHLESVQELINEKLIRTKGLWGPVHELGRNQQRQEWEFPPHTTEATCNLWCVYVHETVLGIPRSRANIALWPPVREKRVRIYLSKGPNVKNWNAWTALETYLQLQEAFGWEPFIRLFTEYRNQTNLPTENVDKMNLWVKMFSHQVQKNLAPFFEAWAWPIQKEVATSLAYLPEWKENIMKLYLLTQMPH | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 113 | Ubiquitination | EGSGVDAKVEPEVKD HCCCCCCCCCHHHHH | 21906983 | ||
| 113 (in isoform 1) | Ubiquitination | - | 21890473 | ||
| 113 (in isoform 2) | Ubiquitination | - | 21890473 | ||
| 119 | Ubiquitination | AKVEPEVKDSLGVYC CCCCHHHHHHCEEEE | - | ||
| 121 | Phosphorylation | VEPEVKDSLGVYCID CCHHHHHHCEEEEEE | 29759185 | ||
| 125 | Phosphorylation | VKDSLGVYCIDAYNE HHHHCEEEEEECCCC | 29759185 | ||
| 137 | Ubiquitination | YNETMTEKLVKFMKC CCCHHHHHHHHHHHC | - | ||
| 143 | Ubiquitination | EKLVKFMKCGGGLLI HHHHHHHHCCCCEEE | - | ||
| 182 | Phosphorylation | VTSVAGIYFTDNKGD EEEEEEEEECCCCCC | 22210691 | ||
| 184 | Phosphorylation | SVAGIYFTDNKGDTS EEEEEEECCCCCCCC | 22210691 | ||
| 194 | Ubiquitination | KGDTSFFKVSKKMPK CCCCCEEEECCCCCC | 21906983 | ||
| 194 (in isoform 2) | Ubiquitination | - | 21890473 | ||
| 194 (in isoform 1) | Ubiquitination | - | 21890473 | ||
| 274 (in isoform 2) | Ubiquitination | - | 21890473 | ||
| 274 | Ubiquitination | RVVVTGHKVLFTVGK EEEECCCEEEEEECC | 21890473 | ||
| 274 (in isoform 1) | Ubiquitination | - | 21890473 | ||
| 281 | Ubiquitination | KVLFTVGKLGPFLLN EEEEEECCHHHHHHH | - | ||
| 281 (in isoform 2) | Ubiquitination | - | - | ||
| 369 | Sumoylation | QAWWWAFKNPGVSPL EEEEHHHCCCCCCCC | - | ||
| 406 | Ubiquitination | PGPFRTPKAGIRTYH CCCCCCCCCCCEEEE | - | ||
| 416 | Phosphorylation | IRTYHFRSTLAEFQV CEEEEHHHHHHHHHH | 22210691 | ||
| 417 | Phosphorylation | RTYHFRSTLAEFQVI EEEEHHHHHHHHHHH | 22210691 | ||
| 434 (in isoform 2) | Ubiquitination | - | 21890473 | ||
| 434 (in isoform 1) | Ubiquitination | - | 21890473 | ||
| 434 | Ubiquitination | RKRGNVEKGWLAKLG CCCCCCCCCHHHHCC | 21890473 | ||
| 439 | Ubiquitination | VEKGWLAKLGPDGAA CCCCHHHHCCCCCCE | - | ||
| 439 (in isoform 2) | Ubiquitination | - | - | ||
| 601 | Ubiquitination | INRCCLDKPTKSITC EEEECCCCCCCEEEE | - | ||
| 632 | Ubiquitination | GSVPVTVKGAVHAPY CCCCEEEECEEECCC | - | ||
| 641 | Ubiquitination | AVHAPYYKLGETTLE EEECCCCCCCCCCHH | - | ||
| 645 | Phosphorylation | PYYKLGETTLEEWKR CCCCCCCCCHHHHHH | 28152594 | ||
| 646 | Phosphorylation | YYKLGETTLEEWKRR CCCCCCCCHHHHHHH | 28152594 | ||
| 651 (in isoform 1) | Ubiquitination | - | 21890473 | ||
| 651 (in isoform 2) | Ubiquitination | - | 21890473 | ||
| 651 | Ubiquitination | ETTLEEWKRRIQENP CCCHHHHHHHHHHCC | 21906983 | ||
| 750 (in isoform 2) | Ubiquitination | - | 21890473 | ||
| 750 | Ubiquitination | NEKLIRTKGLWGPVH HHHHHHCCCCCCCHH | 21890473 | ||
| 750 (in isoform 1) | Ubiquitination | - | 21890473 | ||
| 809 | Sumoylation | LWPPVREKRVRIYLS CCCCCCCCEEEEEEE | - | ||
| 809 | Ubiquitination | LWPPVREKRVRIYLS CCCCCCCCEEEEEEE | - | ||
| 809 (in isoform 2) | Ubiquitination | - | - | ||
| 817 (in isoform 2) | Ubiquitination | - | 21890473 | ||
| 817 (in isoform 1) | Ubiquitination | - | 21890473 | ||
| 817 | Ubiquitination | RVRIYLSKGPNVKNW EEEEEEECCCCCCCC | 21890473 | ||
| 865 (in isoform 1) | Ubiquitination | - | 21890473 | ||
| 865 (in isoform 2) | Ubiquitination | - | 21890473 | ||
| 865 | Ubiquitination | LPTENVDKMNLWVKM CCCCCHHHHHHHHHH | 21890473 | ||
| 874 | Phosphorylation | NLWVKMFSHQVQKNL HHHHHHHHHHHHHCH | - | ||
| 907 | Ubiquitination | LAYLPEWKENIMKLY HHHCHHHHHHHHHHH | 21906983 | ||
| 907 (in isoform 2) | Ubiquitination | - | 21890473 | ||
| 907 (in isoform 1) | Ubiquitination | - | 21890473 | ||
| 912 | Ubiquitination | EWKENIMKLYLLTQM HHHHHHHHHHHHHCC | 21890473 | ||
| 912 (in isoform 1) | Ubiquitination | - | 21890473 | ||
| 914 | Phosphorylation | KENIMKLYLLTQMPH HHHHHHHHHHHCCCC | 24719451 | ||
| 917 | Phosphorylation | IMKLYLLTQMPH--- HHHHHHHHCCCC--- | 24719451 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TCAF1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TCAF1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TCAF1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| FBLN4_HUMAN | EFEMP2 | physical | 16189514 | |
| SF3B4_HUMAN | SF3B4 | physical | 16189514 | |
| ZN263_HUMAN | ZNF263 | physical | 25416956 | |
| SPY2_HUMAN | SPRY2 | physical | 25416956 | |
| SF3B4_HUMAN | SF3B4 | physical | 25416956 | |
| IKZF3_HUMAN | IKZF3 | physical | 25416956 | |
| TFP11_HUMAN | TFIP11 | physical | 25416956 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
