UniProt ID | LYZL1_HUMAN | |
---|---|---|
UniProt AC | Q6UWQ5 | |
Protein Name | Lysozyme-like protein 1 | |
Gene Name | LYZL1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 148 | |
Subcellular Localization | Secreted . | |
Protein Description | ||
Protein Sequence | MKAAGILTLIGCLVTGAESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAQTVLDDGSIDYGIFQINSFAWCRRGKLKENNHCHVACSALITDDLTDAIICARKIVKETQGMNYWQGWKKHCEGRDLSEWKKGCEVS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
7 (in isoform 2) | Phosphorylation | - | 2.89 | 30206219 | |
10 (in isoform 2) | Phosphorylation | - | 2.85 | 30206219 | |
12 (in isoform 2) | Phosphorylation | - | 1.88 | 30206219 | |
15 (in isoform 2) | Phosphorylation | - | 20.09 | - | |
22 (in isoform 2) | Phosphorylation | - | 7.59 | - | |
23 (in isoform 2) | Phosphorylation | - | 32.82 | - | |
58 | N-linked_Glycosylation | AYYESGYNTTAQTVL HHHHCCCCCCEEEEC | 34.18 | UniProtKB CARBOHYD | |
120 | Phosphorylation | ARKIVKETQGMNYWQ HHHHHHHHCCCCCHH | 25.38 | - | |
125 | Phosphorylation | KETQGMNYWQGWKKH HHHCCCCCHHHHHHH | 7.10 | - | |
148 | Phosphorylation | WKKGCEVS------- HHCCCCCC------- | 16.53 | 25954137 | |
166 | Phosphorylation | ------------------------- ------------------------- | - | ||
171 | Phosphorylation | ------------------------------ ------------------------------ | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LYZL1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LYZL1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LYZL1_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...