| UniProt ID | KCD17_HUMAN | |
|---|---|---|
| UniProt AC | Q8N5Z5 | |
| Protein Name | BTB/POZ domain-containing protein KCTD17 | |
| Gene Name | KCTD17 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 321 | |
| Subcellular Localization | Cytoplasm . | |
| Protein Description | Is a positive regulator of ciliogenesis, playing a crucial role in the initial steps of axoneme extension. It acts as a substrate-adapter for CUL3-RING ubiquitin ligase complexes which mediate the ubiquitination and subsequent proteasomal degradation of TCHP, a protein involved in ciliogenesis down-regulation. [PubMed: 25270598 May be involved in endoplasmic reticulum calcium ion homeostasis] | |
| Protein Sequence | MQTPRPAMRMEAGEAAPPAGAGGRAAGGWGKWVRLNVGGTVFLTTRQTLCREQKSFLSRLCQGEELQSDRDETGAYLIDRDPTYFGPILNFLRHGKLVLDKDMAEEGVLEEAEFYNIGPLIRIIKDRMEEKDYTVTQVPPKHVYRVLQCQEEELTQMVSTMSDGWRFEQLVNIGSSYNYGSEDQAEFLCVVSKELHSTPNGLSSESSRKTKSTEEQLEEQQQQEEEVEEVEVEQVQVEADAQEKAQSSQDPANLFSLPPLPPPPLPAGGSRPHPLRPEAELAVRASPRPLARPQSCHPCCYKPEAPGCEAPDHLQGLGVPI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 3 | Phosphorylation | -----MQTPRPAMRM -----CCCCCCCCCC | 21.70 | 29759185 | |
| 31 | Ubiquitination | RAAGGWGKWVRLNVG CCCCCCCCEEEEECC | 35.69 | - | |
| 54 | Ubiquitination | QTLCREQKSFLSRLC HHHHHHHHHHHHHHH | 38.12 | - | |
| 58 | Phosphorylation | REQKSFLSRLCQGEE HHHHHHHHHHHCCCC | 22.61 | 24719451 | |
| 96 | Ubiquitination | LNFLRHGKLVLDKDM HHHHHCCCEEECHHH | 29.33 | - | |
| 101 | Ubiquitination | HGKLVLDKDMAEEGV CCCEEECHHHHHCCC | 45.29 | - | |
| 133 | Phosphorylation | DRMEEKDYTVTQVPP HHHHCCCCEEEECCH | 17.74 | 27642862 | |
| 134 | Phosphorylation | RMEEKDYTVTQVPPK HHHCCCCEEEECCHH | 27.49 | - | |
| 136 | Phosphorylation | EEKDYTVTQVPPKHV HCCCCEEEECCHHHH | 18.95 | - | |
| 203 | Phosphorylation | HSTPNGLSSESSRKT HCCCCCCCCHHHHHC | 33.20 | - | |
| 204 | Phosphorylation | STPNGLSSESSRKTK CCCCCCCCHHHHHCC | 46.68 | 28555341 | |
| 206 | Phosphorylation | PNGLSSESSRKTKST CCCCCCHHHHHCCCH | 37.07 | 28555341 | |
| 207 | Phosphorylation | NGLSSESSRKTKSTE CCCCCHHHHHCCCHH | 33.47 | - | |
| 246 (in isoform 2) | Phosphorylation | - | 55.47 | 22210691 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of KCD17_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KCD17_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KCD17_HUMAN !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
