UniProt ID | LRC18_HUMAN | |
---|---|---|
UniProt AC | Q8N456 | |
Protein Name | Leucine-rich repeat-containing protein 18 | |
Gene Name | LRRC18 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 261 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | May be involved in the regulation of spermatogenesis and sperm maturation.. | |
Protein Sequence | MVKGEKGPKGKKITLKVARNCIKITFDGKKRLDLSKMGITTFPKCILRLSDMDELDLSRNLIRKIPDSISKFQNLRWLDLHSNYIDKLPESIGQMTSLLYLNVSNNRLTSNGLPVELKQLKNIRAVNLGLNHLDSVPTTLGALKELHEVGLHDNLLNNIPVSISKLPKLKKLNIKRNPFPKPGESEIFIDSIRRLENLYVVEEKDLCAACLRKCQNARDNLNRIKNMATTTPRKTIFPNLISPNSMAKDSWEDWRIRLTSS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
14 | Phosphorylation | GPKGKKITLKVARNC CCCCCCEEEEEECCE | 29.43 | 24719451 | |
82 | Phosphorylation | LRWLDLHSNYIDKLP CCCHHCCCHHHHHCC | 38.33 | 25159151 | |
84 | Phosphorylation | WLDLHSNYIDKLPES CHHCCCHHHHHCCHH | 17.32 | 27762562 | |
96 | Phosphorylation | PESIGQMTSLLYLNV CHHHHHCCEEEEEEC | 14.34 | - | |
162 | Phosphorylation | LLNNIPVSISKLPKL HHHCCCCCHHHCCCC | 18.78 | 25693802 | |
164 | Phosphorylation | NNIPVSISKLPKLKK HCCCCCHHHCCCCCC | 22.19 | 25693802 | |
170 | Ubiquitination | ISKLPKLKKLNIKRN HHHCCCCCCCCCCCC | 62.43 | - | |
185 | Phosphorylation | PFPKPGESEIFIDSI CCCCCCCCCEEHHHH | 41.74 | 30622161 | |
191 | Phosphorylation | ESEIFIDSIRRLENL CCCEEHHHHHHHCCE | 17.12 | 30622161 | |
245 | Phosphorylation | PNLISPNSMAKDSWE CCCCCCCCCCCCCHH | 24.41 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LRC18_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LRC18_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LRC18_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of LRC18_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...