| UniProt ID | NUD18_HUMAN | |
|---|---|---|
| UniProt AC | Q6ZVK8 | |
| Protein Name | 8-oxo-dGDP phosphatase NUDT18 | |
| Gene Name | NUDT18 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 323 | |
| Subcellular Localization | ||
| Protein Description | Mediates the hydrolyzis of oxidized nucleoside diphosphate derivatives. Hydrolyzes 8-oxo-7,8-dihydroguanine (8-oxo-Gua)-containing deoxyribo- and ribonucleoside diphosphates to the monophosphates. Hydrolyzes 8-oxo-dGDP and 8-oxo-GDP with the same efficiencies. Hydrolyzes also 8-OH-dADP and 2-OH-dADP. Exhibited no or minimal hydrolyzis activity against 8-oxo-dGTP, 8-oxo-GTP, dGTP, GTP, dGDP and GDP. Probably removes oxidized guanine nucleotides from both the DNA and RNA precursor pools.. | |
| Protein Sequence | MASEGLAGALASVLAGQGSSVHSCDSAPAGEPPAPVRLRKNVCYVVLAVFLSEQDEVLLIQEAKRECRGSWYLPAGRMEPGETIVEALQREVKEEAGLHCEPETLLSVEERGPSWVRFVFLARPTGGILKTSKEADAESLQAAWYPRTSLPTPLRAHDILHLVELAAQYRQQARHPLILPQELPCDLVCQRLVATFTSAQTVWVLVGTVGMPHLPVTACGLDPMEQRGGMKMAVLRLLQECLTLHHLVVEIKGLLGLQHLGRDHSDGICLNVLVTVAFRSPGIQDEPPKVRGENFSWWKVMEEDLQSQLLQRLQGSSVVPVNR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 (in isoform 2) | Phosphorylation | - | 19.11 | 22210691 | |
| 5 (in isoform 2) | Phosphorylation | - | 20.52 | 24043423 | |
| 12 (in isoform 2) | Phosphorylation | - | 20.65 | 24043423 | |
| 13 (in isoform 2) | Phosphorylation | - | 3.36 | 22210691 | |
| 15 (in isoform 2) | Phosphorylation | - | 13.20 | 24043423 | |
| 20 (in isoform 2) | Phosphorylation | - | 30.58 | 24043423 | |
| 22 (in isoform 2) | Phosphorylation | - | 25.34 | 24043423 | |
| 23 (in isoform 2) | Phosphorylation | - | 19.91 | 24043423 | |
| 93 | Ubiquitination | EALQREVKEEAGLHC HHHHHHHHHHHCCCC | 45.12 | - | |
| 148 | Phosphorylation | QAAWYPRTSLPTPLR HHHHCCCCCCCCCCC | 30.06 | - | |
| 149 | Phosphorylation | AAWYPRTSLPTPLRA HHHCCCCCCCCCCCH | 33.36 | - | |
| 280 | Phosphorylation | LVTVAFRSPGIQDEP EEEEHHCCCCCCCCC | 22.48 | 23403867 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NUD18_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NUD18_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NUD18_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| TIFA_HUMAN | TIFA | physical | 16189514 | |
| BACD1_HUMAN | KCTD13 | physical | 16189514 | |
| KR412_HUMAN | KRTAP4-12 | physical | 16189514 | |
| EVI5L_HUMAN | EVI5L | physical | 16189514 | |
| EVI5L_HUMAN | EVI5L | physical | 19060904 | |
| R3GEF_HUMAN | RAB3IL1 | physical | 19060904 | |
| 5NTC_HUMAN | NT5C2 | physical | 19060904 | |
| PRAF1_HUMAN | RABAC1 | physical | 19060904 | |
| DUT_HUMAN | DUT | physical | 19060904 | |
| MTNB_HUMAN | APIP | physical | 19060904 | |
| PUR6_HUMAN | PAICS | physical | 19060904 | |
| DHYS_HUMAN | DHPS | physical | 19060904 | |
| DHB14_HUMAN | HSD17B14 | physical | 19060904 | |
| NAT9_HUMAN | NAT9 | physical | 19060904 | |
| TRBP2_HUMAN | TARBP2 | physical | 19060904 | |
| FSBP_HUMAN | RAD54B | physical | 19060904 | |
| RA54B_HUMAN | RAD54B | physical | 19060904 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
