UniProt ID | DHB14_HUMAN | |
---|---|---|
UniProt AC | Q9BPX1 | |
Protein Name | 17-beta-hydroxysteroid dehydrogenase 14 | |
Gene Name | HSD17B14 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 270 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | Has NAD-dependent 17-beta-hydroxysteroid dehydrogenase activity. Converts oestradiol to oestrone. The physiological substrate is not known. Acts on oestradiol and 5-androstene-3-beta,17-beta-diol (in vitro).. | |
Protein Sequence | MATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIPS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
7 | Phosphorylation | -MATGTRYAGKVVVV -CCCCCEECCEEEEE | 21.39 | 24719451 | |
15 | Phosphorylation | AGKVVVVTGGGRGIG CCEEEEEECCCCCCC | 20.64 | 24719451 | |
71 | Phosphorylation | TQEDDVKTLVSETIR CCHHHHHHHHHHHHH | 32.04 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DHB14_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DHB14_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DHB14_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NTAQ1_HUMAN | WDYHV1 | physical | 16189514 | |
DHB14_HUMAN | HSD17B14 | physical | 16189514 | |
NUD18_HUMAN | NUDT18 | physical | 16189514 | |
DHB14_HUMAN | HSD17B14 | physical | 25416956 | |
NTAQ1_HUMAN | WDYHV1 | physical | 25416956 | |
TB22B_HUMAN | TBC1D22B | physical | 25416956 | |
SR1IP_HUMAN | SREK1IP1 | physical | 25416956 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...