dbPTM

DHB14_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	DHB14_HUMAN
UniProt AC	Q9BPX1
Protein Name	17-beta-hydroxysteroid dehydrogenase 14
Gene Name	HSD17B14
Organism	Homo sapiens (Human).
Sequence Length	270
Subcellular Localization	Cytoplasm .
Protein Description	Has NAD-dependent 17-beta-hydroxysteroid dehydrogenase activity. Converts oestradiol to oestrone. The physiological substrate is not known. Acts on oestradiol and 5-androstene-3-beta,17-beta-diol (in vitro)..
Protein Sequence	MATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIPS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
7	Phosphorylation	-MATGTRYAGKVVVV -CCCCCEECCEEEEE	21.39	24719451
15	Phosphorylation	AGKVVVVTGGGRGIG CCEEEEEECCCCCCC	20.64	24719451
71	Phosphorylation	TQEDDVKTLVSETIR CCHHHHHHHHHHHHH	32.04	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of DHB14_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of DHB14_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of DHB14_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
NTAQ1_HUMAN	WDYHV1	physical	16189514
DHB14_HUMAN	HSD17B14	physical	16189514
NUD18_HUMAN	NUDT18	physical	16189514
DHB14_HUMAN	HSD17B14	physical	25416956
NTAQ1_HUMAN	WDYHV1	physical	25416956
TB22B_HUMAN	TBC1D22B	physical	25416956
SR1IP_HUMAN	SREK1IP1	physical	25416956

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of DHB14_HUMAN

Related Literatures of Post-Translational Modification