| UniProt ID | NAT9_HUMAN | |
|---|---|---|
| UniProt AC | Q9BTE0 | |
| Protein Name | N-acetyltransferase 9 | |
| Gene Name | NAT9 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 207 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MRLNQNTLLLGKKVVLVPYTSEHVPSRYHEWMKSEELQRLTASEPLTLEQEYAMQCSWQEDADKCTFIVLDAEKWQAQPGATEESCMVGDVNLFLTDLEDLTLGEIEVMIAEPSCRGKGLGTEAVLAMLSYGVTTLGLTKFEAKIGQGNEPSIRMFQKLHFEQVATSSVFQEVTLRLTVSESEHQWLLEQTSHVEEKPYRDGSAEPC | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 12 | Ubiquitination | QNTLLLGKKVVLVPY CCCEECCCEEEEEEC | 42.22 | - | |
| 32 (in isoform 2) | Ubiquitination | - | 2.89 | 21906983 | |
| 33 | Acetylation | SRYHEWMKSEELQRL HHHHHHHCHHHHHHH | 56.65 | 23236377 | |
| 33 | Ubiquitination | SRYHEWMKSEELQRL HHHHHHHCHHHHHHH | 56.65 | 21906983 | |
| 33 (in isoform 1) | Ubiquitination | - | 56.65 | 21906983 | |
| 143 (in isoform 2) | Ubiquitination | - | 16.34 | 21906983 | |
| 144 | Ubiquitination | GLTKFEAKIGQGNEP CEEEEEEECCCCCCC | 39.92 | 21906983 | |
| 144 (in isoform 1) | Ubiquitination | - | 39.92 | 21906983 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NAT9_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NAT9_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NAT9_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| LC7L2_HUMAN | LUC7L2 | physical | 16169070 | |
| ERG28_HUMAN | C14orf1 | physical | 16169070 | |
| CE126_HUMAN | KIAA1377 | physical | 16169070 | |
| DPYL1_HUMAN | CRMP1 | physical | 16169070 | |
| NAT9_HUMAN | NAT9 | physical | 25416956 | |
| MCA3_HUMAN | EEF1E1 | physical | 21516116 | |
| CHK1_HUMAN | CHEK1 | physical | 28514442 | |
| MPP6_HUMAN | MPP6 | physical | 28514442 | |
| FLII_HUMAN | FLII | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
