dbPTM

IAH1_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	IAH1_YEAST
UniProt AC	P41734
Protein Name	Isoamyl acetate-hydrolyzing esterase {ECO:0000303\|Ref.2}
Gene Name	IAH1 {ECO:0000303\|PubMed:10855721, ECO:0000312\|EMBL:CAA63350.1}
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	238
Subcellular Localization
Protein Description	Plays a crucial role in the hydrolysis of isoamyl acetate in sake mash (Ref.2). Hydrolyzes short chain esters from acetate (C2) to hexanoate (C6), showing more specificity for shorter chain exters. No activity for decanoate (C10) esters. [PubMed: 21069734]
Protein Sequence	MDYEKFLLFGDSITEFAFNTRPIEDGKDQYALGAALVNEYTRKMDILQRGFKGYTSRWALKILPEILKHESNIVMATIFLGANDACSAGPQSVPLPEFIDNIRQMVSLMKSYHIRPIIIGPGLVDREKWEKEKSEEIALGYFRTNENFAIYSDALAKLANEEKVPFVALNKAFQQEGGDAWQQLLTDGLHFSGKGYKIFHDELLKVIETFYPQYHPKNMQYKLKDWRDVLDDGSNIMS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
107	Phosphorylation	DNIRQMVSLMKSYHI HHHHHHHHHHHHCCC	19.87	30377154
111	Phosphorylation	QMVSLMKSYHIRPII HHHHHHHHCCCCCEE	14.15	30377154
217	Acetylation	FYPQYHPKNMQYKLK HCCCCCCCCCCHHHC	52.30	24489116

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of IAH1_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of IAH1_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of IAH1_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GSHR_YEAST	GLR1	genetic	21623372
PDX3_YEAST	PDX3	genetic	21623372
ARO1_YEAST	ARO1	genetic	21623372
GGPPS_YEAST	BTS1	genetic	21623372
MTAP_YEAST	MEU1	genetic	21623372
CHMU_YEAST	ARO7	genetic	21623372
QCR2_YEAST	QCR2	genetic	21623372
SDT1_YEAST	SDT1	genetic	21623372
QCR1_YEAST	COR1	genetic	21623372
PUR2_YEAST	ADE5,7	genetic	21623372
SYSM_YEAST	DIA4	genetic	21623372
SPEE_YEAST	SPE3	genetic	21623372
GPX3_YEAST	HYR1	genetic	21623372
QCR9_YEAST	QCR9	genetic	21623372
HFA1_YEAST	HFA1	genetic	21623372
FABG_YEAST	OAR1	genetic	21623372
COX5A_YEAST	COX5A	genetic	21623372
GLG1_YEAST	GLG1	genetic	21623372
ATPF_YEAST	ATP4	genetic	21623372
FADH_YEAST	SFA1	genetic	21623372
ELO3_YEAST	ELO3	genetic	21623372
COQ2_YEAST	COQ2	genetic	21623372
ADH3_YEAST	ADH3	genetic	21623372
ATPO_YEAST	ATP5	genetic	21623372
FKS3_YEAST	FKS3	genetic	21623372
IAH1_YEAST	IAH1	physical	21069734
SHE1_YEAST	SHE1	genetic	27708008
IMG2_YEAST	IMG2	genetic	27708008
PALF_YEAST	RIM8	genetic	27708008
RTF1_YEAST	RTF1	genetic	27708008
MNT2_YEAST	MNT2	genetic	27708008
FHN1_YEAST	FHN1	genetic	27708008
EAF6_YEAST	EAF6	genetic	27708008
DLT1_YEAST	DLT1	genetic	27708008
SIN3_YEAST	SIN3	genetic	27708008
MOD5_YEAST	MOD5	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of IAH1_YEAST

Related Literatures of Post-Translational Modification