UniProt ID | IAH1_YEAST | |
---|---|---|
UniProt AC | P41734 | |
Protein Name | Isoamyl acetate-hydrolyzing esterase {ECO:0000303|Ref.2} | |
Gene Name | IAH1 {ECO:0000303|PubMed:10855721, ECO:0000312|EMBL:CAA63350.1} | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 238 | |
Subcellular Localization | ||
Protein Description | Plays a crucial role in the hydrolysis of isoamyl acetate in sake mash (Ref.2). Hydrolyzes short chain esters from acetate (C2) to hexanoate (C6), showing more specificity for shorter chain exters. No activity for decanoate (C10) esters. [PubMed: 21069734] | |
Protein Sequence | MDYEKFLLFGDSITEFAFNTRPIEDGKDQYALGAALVNEYTRKMDILQRGFKGYTSRWALKILPEILKHESNIVMATIFLGANDACSAGPQSVPLPEFIDNIRQMVSLMKSYHIRPIIIGPGLVDREKWEKEKSEEIALGYFRTNENFAIYSDALAKLANEEKVPFVALNKAFQQEGGDAWQQLLTDGLHFSGKGYKIFHDELLKVIETFYPQYHPKNMQYKLKDWRDVLDDGSNIMS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
107 | Phosphorylation | DNIRQMVSLMKSYHI HHHHHHHHHHHHCCC | 19.87 | 30377154 | |
111 | Phosphorylation | QMVSLMKSYHIRPII HHHHHHHHCCCCCEE | 14.15 | 30377154 | |
217 | Acetylation | FYPQYHPKNMQYKLK HCCCCCCCCCCHHHC | 52.30 | 24489116 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IAH1_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IAH1_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IAH1_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...