UniProt ID | E2F2_DROME | |
---|---|---|
UniProt AC | O77051 | |
Protein Name | Transcription factor E2F2 | |
Gene Name | E2f2 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 370 | |
Subcellular Localization | Nucleus . | |
Protein Description | Transcriptional repressor that binds to E2f sites and represses E2f-regulated target genes. Binding to E2f sites requires transcription factor Dp. Acts synergistically with Rbf2 to antagonize E2f1-mediated transcriptional activation. Component of the DREAM complex, a multiprotein complex that can both act as a transcription activator or repressor depending on the context. The DREAM complex is required for recruiting E2f2 at differentiation-specific promoters and for stabilizing E2f2-Rbf complexes during S phase. During development, the complex represses transcription of developmentally controlled E2f target genes. During oogenesis, plays a role in restricting DNA synthesis to sites of chorion gene amplification in late stage ovarian follicle cells. Plays an inhibitory role in ionizing radiation (IR)-induced p53-independent apoptosis. May be involved in cell cycle exit by temporarily limiting CycE-dependent activation of E2f-regulated transcription.. | |
Protein Sequence | MYKRKTASIVKRDSSAAGTTSSAMMMKVDSAETSVRSQSYESTPVSMDTSPDPPTPIKSPSNSQSQSQPGQQRSVGSLVLLTQKFVDLVKANEGSIDLKAATKILDVQKRRIYDITNVLEGIGLIDKGRHCSLVRWRGGGFNNAKDQENYDLARSRTNHLKMLEDDLDRQLEYAQRNLRYVMQDPSNRSYAYVTRDDLLDIFGDDSVFTIPNYDEEVDIKRNHYELAVSLDNGSAIDIRLVTNQGKSTTNPHDVDGFFDYHRLDTPSPSTSSHSSEDGNAPACAGNVITDEHGYSCNPGMKDEMKLLENELTAKIIFQNYLSGHSLRRFYPDDPNLENPPLLQLNPPQEDFNFALKSDEGICELFDVQCS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
59 | Phosphorylation | DPPTPIKSPSNSQSQ CCCCCCCCCCCCCCC | 22668510 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of E2F2_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of E2F2_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of E2F2_DROME !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...