dbPTM

JANA_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	JANA_DROME
UniProt AC	P20348
Protein Name	Sex-regulated protein janus-A
Gene Name	janA
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	135
Subcellular Localization
Protein Description	JanA and janB regulate somatic sex differentiation..
Protein Sequence	MNRLQLLSKGLRLIHKMSEEALAGVPLVHISPEGIFKYVMINVFDGGDASKAVIRGFADCTWHADIFEREEEVFKKLGLRAECPGGGRIEHNPEKKYLKVYGYSQGFGKADHAQTKRILATKYPDYTIEISDEGY

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
2 (in isoform 2)	Phosphorylation	-	54.06	27794539
109	Acetylation	GYSQGFGKADHAQTK EECCCCCCCCHHHHH	48.67	21791702

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of JANA_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of JANA_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of JANA_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of JANA_DROME

Related Literatures of Post-Translational Modification