UniProt ID | CSN8_DROME | |
---|---|---|
UniProt AC | Q7KTH8 | |
Protein Name | COP9 signalosome complex subunit 8 | |
Gene Name | CSN8 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 182 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | Probable component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of the SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF. The CSN complex plays an essential role in oogenesis and embryogenesis and is required for proper photoreceptor R cell differentiation and promote lamina glial cell migration or axon targeting. It also promotes Ubl-dependent degradation of cyclin E (CycE) during early oogenesis.. | |
Protein Sequence | MHLNKYSEVVERLENEEFEQVELGAEVYQQLLAIYLYQNKLADAKLLWMRVPANLRDDKELIQLNLLNIALQNNNYADFFKHIKYEWSERVKSPVEDLLNKQREELFKLMGSAYMSIYQHNLLELSLMSEDELKHACAALNWTEELDGDRVILKPKVQEAPPARGNDDQLLKLTEFVTFLEN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
93 | Phosphorylation | EWSERVKSPVEDLLN HHHHHCCCHHHHHHH | 31.18 | 21082442 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CSN8_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CSN8_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CSN8_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CSN3_DROME | CSN3 | physical | 14605208 | |
UBCD4_DROME | UbcD4 | physical | 14605208 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...