dbPTM

SCLLA_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SCLLA_DROME
UniProt AC	Q9VTH4
Protein Name	Protein scylla
Gene Name	scyl
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	280
Subcellular Localization	Cytoplasm.
Protein Description	Inhibits cell growth by regulating the Tor pathway upstream of the Tsc1-Tsc2 complex and downstream of Akt1. Acts as cell death activator during head development..
Protein Sequence	MKMDVIAREQIIYGSLQGSNKNKDWTSRLPPPSAYTLDLMSKKAKTTTGGSSNGSNATATSTTTSTSSSIKHKQPAGSSNNNVGQSQSKKTKPSGSYNSNSNYYYYAADEEEGGSADYALSNYDKKAVEELSLRLLDELRAAKSRHLTCTEVSLPCDLTPSVAREIIRVSEKEPRGIRGCTIYIEFEDEPKNSRRIASIKVDSDTVSTFEVYLTLRQDHRGWTSLLPQFMKSLARTITISPEYTITKNKLYSADGLGARRSYSFGSHAHRPSAAIATPTN

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of SCLLA_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SCLLA_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SCLLA_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SCLLA_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SCLLA_DROME

Related Literatures of Post-Translational Modification