UniProt ID | CH033_HUMAN | |
---|---|---|
UniProt AC | Q9H7E9 | |
Protein Name | UPF0488 protein C8orf33 | |
Gene Name | C8orf33 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 229 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MAALGHLAGEAAAAPGPGTPCASRGARLPGPVSSARNPSTVCLCPEQPTCSNADSRAHPLGDEGGTASKKQKNKKKTRNRASVANGGEKASEKLAPEEVPLSAEAQAQQLAQELAWCVEQLELGLKRQKPTPKQKEQAIGAIRTLRSKRTPLPRKRQLMHSLFGDYRAQMEAEWREALRALRAAAYSAQVQPVDGATRKKSQRVCRPRSIWRAKATLDMPDEEFRFNFF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MAALGHLAG ------CCCHHHHHH | 16.05 | 19413330 | |
19 | Phosphorylation | AAAPGPGTPCASRGA HCCCCCCCCCCCCCC | 20.51 | 29255136 | |
23 | Phosphorylation | GPGTPCASRGARLPG CCCCCCCCCCCCCCC | 37.65 | 29255136 | |
24 | Methylation | PGTPCASRGARLPGP CCCCCCCCCCCCCCC | 25.02 | - | |
27 | Methylation | PCASRGARLPGPVSS CCCCCCCCCCCCCCC | 44.21 | 24129315 | |
33 | Phosphorylation | ARLPGPVSSARNPST CCCCCCCCCCCCCCC | 22.78 | 24732914 | |
34 | Phosphorylation | RLPGPVSSARNPSTV CCCCCCCCCCCCCCE | 31.33 | 24732914 | |
39 | Phosphorylation | VSSARNPSTVCLCPE CCCCCCCCCEEECCC | 36.70 | 21712546 | |
40 | Phosphorylation | SSARNPSTVCLCPEQ CCCCCCCCEEECCCC | 19.25 | 30576142 | |
66 | Phosphorylation | PLGDEGGTASKKQKN CCCCCCCCCCHHHHC | 38.32 | 25159151 | |
68 | Phosphorylation | GDEGGTASKKQKNKK CCCCCCCCHHHHCCC | 39.98 | 23312004 | |
69 | Acetylation | DEGGTASKKQKNKKK CCCCCCCHHHHCCCH | 57.68 | 25953088 | |
70 | Ubiquitination | EGGTASKKQKNKKKT CCCCCCHHHHCCCHH | 65.10 | 24816145 | |
82 | Phosphorylation | KKTRNRASVANGGEK CHHCCHHHHHCCCCH | 20.65 | 22496350 | |
82 | O-linked_Glycosylation | KKTRNRASVANGGEK CHHCCHHHHHCCCCH | 20.65 | 28510447 | |
129 | Ubiquitination | ELGLKRQKPTPKQKE HHHHCCCCCCHHHHH | 55.69 | 24816145 | |
135 | Ubiquitination | QKPTPKQKEQAIGAI CCCCHHHHHHHHHHH | 58.90 | 29967540 | |
144 | Phosphorylation | QAIGAIRTLRSKRTP HHHHHHHHHHHCCCC | 22.02 | 28555341 | |
161 | Phosphorylation | RKRQLMHSLFGDYRA CHHHHHHHHHHCHHH | 16.07 | 28857561 | |
166 | Phosphorylation | MHSLFGDYRAQMEAE HHHHHHCHHHHHHHH | 14.29 | 24719451 | |
186 | Phosphorylation | RALRAAAYSAQVQPV HHHHHHHHHCCCCCC | 10.38 | 21945579 | |
187 | Phosphorylation | ALRAAAYSAQVQPVD HHHHHHHHCCCCCCC | 13.90 | 21945579 | |
209 | Phosphorylation | QRVCRPRSIWRAKAT CCCCCCHHHHEEEEE | 29.23 | 24719451 | |
214 | Ubiquitination | PRSIWRAKATLDMPD CHHHHEEEEECCCCC | 33.07 | 24816145 | |
216 | Phosphorylation | SIWRAKATLDMPDEE HHHEEEEECCCCCHH | 23.68 | 23312004 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CH033_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CH033_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CH033_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY. |