UniProt ID | FST_HUMAN | |
---|---|---|
UniProt AC | P19883 | |
Protein Name | Follistatin | |
Gene Name | FST | |
Organism | Homo sapiens (Human). | |
Sequence Length | 344 | |
Subcellular Localization | Secreted. | |
Protein Description | Binds directly to activin and functions as an activin antagonist. Specific inhibitor of the biosynthesis and secretion of pituitary follicle stimulating hormone (FSH).. | |
Protein Sequence | MVRARHQPGGLCLLLLLLCQFMEDRSAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
124 | N-linked_Glycosylation | VCAPDCSNITWKGPV EECCCCCCCCEECCC | 41.88 | UniProtKB CARBOHYD | |
201 | Phosphorylation | RICPEPASSEQYLCG CCCCCCCCCCCEEEC | 45.16 | 25002506 | |
202 | Phosphorylation | ICPEPASSEQYLCGN CCCCCCCCCCEEECC | 30.72 | 25002506 | |
205 | Phosphorylation | EPASSEQYLCGNDGV CCCCCCCEEECCCCC | 10.41 | 25002506 | |
213 | Phosphorylation | LCGNDGVTYSSACHL EECCCCCCHHHHHHH | 24.18 | 25002506 | |
214 | Phosphorylation | CGNDGVTYSSACHLR ECCCCCCHHHHHHHH | 9.75 | 25002506 | |
215 | Phosphorylation | GNDGVTYSSACHLRK CCCCCCHHHHHHHHH | 11.33 | 25002506 | |
216 | Phosphorylation | NDGVTYSSACHLRKA CCCCCHHHHHHHHHH | 25.22 | 25002506 | |
230 | Phosphorylation | ATCLLGRSIGLAYEG HHHHHCCHHHEEECC | 21.14 | 29970186 | |
277 | Phosphorylation | CDELCPDSKSDEPVC CHHHCCCCCCCCCCC | 21.14 | 27251275 | |
288 | N-linked_Glycosylation | EPVCASDNATYASEC CCCCCCCCCCCHHHH | 31.52 | UniProtKB CARBOHYD |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FST_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FST_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FST_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
INHBA_HUMAN | INHBA | physical | 16198295 | |
BMR1A_HUMAN | BMPR1A | physical | 16198295 | |
BMPR2_HUMAN | BMPR2 | physical | 16198295 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...