UniProt ID | CDC20_MOUSE | |
---|---|---|
UniProt AC | Q9JJ66 | |
Protein Name | Cell division cycle protein 20 homolog | |
Gene Name | Cdc20 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 499 | |
Subcellular Localization | Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton, spindle pole. | |
Protein Description | Required for full ubiquitin ligase activity of the anaphase promoting complex/cyclosome (APC/C) and may confer substrate specificity upon the complex. Is regulated by MAD2L1: in metaphase the MAD2L1-CDC20-APC/C ternary complex is inactive and in anaphase the CDC20-APC/C binary complex is active in degrading substrates. The CDC20-APC/C complex positively regulates the formation of synaptic vesicle clustering at active zone to the presynaptic membrane in postmitotic neurons. CDC20-APC/C-induced degradation of NEUROD2 induces presynaptic differentiation.. | |
Protein Sequence | MAQFVFESDLHSLLQLDAPIPNAPVARWQRKAKEATGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPGGDRFIPQRSASQMEVASFLLSKENQPEDRGTPTKKEHQKAWSLNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWNAGSGDILQLLQMEQPGDYISSVAWIKEGNYLAVGTSNAEVQLWDVQQQKRLRNMTSHSARVSSLSWNSYILSSGSRSGHIHHHDVRVAEHHVATLSGHSQEVCGLRWAPDGRHLASGGNDNIVNVWPSGPGESGWAPLQTFTQHQGAVKAVAWCPWQSNILATGGGTSDRHIRIWNVCSGACLSAVDVHSQVCSILWSPHYKELISGHGFAQNQLVIWKYPTMAKVAELKGHTARVLGLTMSPDGATVASAAADETLRLWRCFEMDPALRREREKASVAKSSLIHQGIR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
36 | Phosphorylation | QRKAKEATGPAPSPM HHHHHHCCCCCCCHH | 44.80 | 25266776 | |
41 | Phosphorylation | EATGPAPSPMRAANR HCCCCCCCHHHHHHH | 33.17 | 26824392 | |
51 | Phosphorylation | RAANRSHSAGRTPGR HHHHHCCCCCCCCCC | 33.39 | 25266776 | |
55 | Phosphorylation | RSHSAGRTPGRTPGK HCCCCCCCCCCCCCC | 29.22 | 26824392 | |
59 | Phosphorylation | AGRTPGRTPGKSSSK CCCCCCCCCCCCCCC | 42.16 | 26824392 | |
66 | Acetylation | TPGKSSSKVQTTPSK CCCCCCCCCCCCCCC | 40.07 | - | |
69 | Phosphorylation | KSSSKVQTTPSKPGG CCCCCCCCCCCCCCC | 43.60 | 25266776 | |
70 | Phosphorylation | SSSKVQTTPSKPGGD CCCCCCCCCCCCCCC | 14.42 | 26824392 | |
72 | Phosphorylation | SKVQTTPSKPGGDRF CCCCCCCCCCCCCCC | 49.76 | 25266776 | |
84 | Phosphorylation | DRFIPQRSASQMEVA CCCCCCCCHHHHHHH | 27.33 | 26643407 | |
86 | Phosphorylation | FIPQRSASQMEVASF CCCCCCHHHHHHHHH | 31.16 | 26239621 | |
92 | Phosphorylation | ASQMEVASFLLSKEN HHHHHHHHHHHCCCC | 22.92 | 25777480 | |
96 | Phosphorylation | EVASFLLSKENQPED HHHHHHHCCCCCCCC | 39.82 | 25777480 | |
106 | Phosphorylation | NQPEDRGTPTKKEHQ CCCCCCCCCCHHHHH | 28.78 | 25263469 | |
108 | Phosphorylation | PEDRGTPTKKEHQKA CCCCCCCCHHHHHHH | 55.37 | 25266776 | |
134 | Phosphorylation | EAKILRLSGKPQNAP HHHHEEECCCCCCCC | 38.03 | 29514104 | |
136 | Ubiquitination | KILRLSGKPQNAPEG HHEEECCCCCCCCCH | 39.80 | - | |
144 | Phosphorylation | PQNAPEGYQNRLKVL CCCCCCHHHHHHHHH | 10.84 | 29514104 | |
153 | Phosphorylation | NRLKVLYSQKATPGS HHHHHHHCCCCCCCC | 22.50 | 29514104 | |
157 | Phosphorylation | VLYSQKATPGSSRKT HHHCCCCCCCCCCCC | 34.91 | 29514104 | |
160 | Phosphorylation | SQKATPGSSRKTCRY CCCCCCCCCCCCCCC | 28.33 | 29514104 | |
161 | Phosphorylation | QKATPGSSRKTCRYI CCCCCCCCCCCCCCC | 43.65 | - | |
452 | Phosphorylation | RVLGLTMSPDGATVA EEEEEEECCCCCHHH | 18.01 | 22067460 | |
490 | Ubiquitination | REKASVAKSSLIHQG HHHHHHHHHHHHHCC | 38.12 | - |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
41 | S | Phosphorylation |
| - |
66 | K | Acetylation |
| 22014574 |
72 | S | Phosphorylation |
| - |
92 | S | Phosphorylation |
| - |
153 | S | Phosphorylation |
| - |
157 | T | Phosphorylation |
| - |
161 | S | Phosphorylation |
| - |
485 | K | ubiquitylation |
| - |
490 | K | ubiquitylation |
| - |
490 | K | ubiquitylation |
| - |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CDC20_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...