UniProt ID | ZFP41_HUMAN | |
---|---|---|
UniProt AC | Q8N8Y5 | |
Protein Name | Zinc finger protein 41 homolog | |
Gene Name | ZFP41 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 198 | |
Subcellular Localization | Nucleus. | |
Protein Description | A putative DNA-binding regulatory protein associated with meiosis in spermatogenesis.. | |
Protein Sequence | MEKPAGRKKKTPTPREEADVQKSALREEKVSGDRKPPERPTVPRKPRTEPCLSPEDEEHVFDAFDASFKDDFEGVPVFIPFQRKKPYECSECGRIFKHKTDHIRHQRVHTGEKPFKCAQCGKAFRHSSDVTKHQRTHTGEKPFKCGECGKAFNCGSNLLKHQKTHTGEKPYECTHCGKAFAYSSCLIRHQKRHPRKKP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
67 | Phosphorylation | VFDAFDASFKDDFEG HHHHHHHHCCCCCCC | 34.37 | 24719451 | |
110 | Phosphorylation | IRHQRVHTGEKPFKC CCCCCCCCCCCCCCH | 44.15 | 23898821 | |
111 | Phosphorylation | RHQRVHTGEKPFKCA CCCCCCCCCCCCCHH | 26.50 | - | |
136 | Phosphorylation | DVTKHQRTHTGEKPF CCCCCCCCCCCCCCE | 19.74 | 23312004 | |
138 | Phosphorylation | TKHQRTHTGEKPFKC CCCCCCCCCCCCEEC | 46.56 | 29496963 | |
139 | Phosphorylation | KHQRTHTGEKPFKCG CCCCCCCCCCCEECC | 33.07 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ZFP41_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ZFP41_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ZFP41_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...