UniProt ID | VAMP2_MOUSE | |
---|---|---|
UniProt AC | P63044 | |
Protein Name | Vesicle-associated membrane protein 2 | |
Gene Name | Vamp2 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 116 | |
Subcellular Localization |
Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane Single-pass type IV membrane protein. Cell junction, synapse, synaptosome. Cell membrane . Neuronal synaptic vesicles. Colocalizes with PRKCZ and WDFY2 in intracellular vesicles. |
|
Protein Description | Involved in the targeting and/or fusion of transport vesicles to their target membrane. [PubMed: 9430681 Modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1 (By similarity] | |
Protein Sequence | MSATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSATAATVP ------CCCCCCCCC | 34.03 | - | |
2 | Phosphorylation | ------MSATAATVP ------CCCCCCCCC | 34.03 | 29514104 | |
35 | Phosphorylation | SNRRLQQTQAQVDEV CCHHHHHHHHHHHHH | 16.95 | 19962314 | |
52 | Ubiquitination | IMRVNVDKVLERDQK HHHCCHHHHHHHHHH | 44.42 | - | |
59 | Ubiquitination | KVLERDQKLSELDDR HHHHHHHHHHHHHHH | 59.26 | - | |
61 | Phosphorylation | LERDQKLSELDDRAD HHHHHHHHHHHHHHH | 43.05 | 25521595 | |
75 | Phosphorylation | DALQAGASQFETSAA HHHHHHHHHHHHHHH | 34.19 | 25521595 | |
79 | Phosphorylation | AGASQFETSAAKLKR HHHHHHHHHHHHHHH | 25.59 | 27742792 | |
80 | Phosphorylation | GASQFETSAAKLKRK HHHHHHHHHHHHHHH | 21.02 | 25521595 | |
83 | Ubiquitination | QFETSAAKLKRKYWW HHHHHHHHHHHHHHH | 55.01 | - |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VAMP2_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VAMP2_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Qualitative and quantitative analyses of protein phosphorylation innaive and stimulated mouse synaptosomal preparations."; Munton R.P., Tweedie-Cullen R., Livingstone-Zatchej M., Weinandy F.,Waidelich M., Longo D., Gehrig P., Potthast F., Rutishauser D.,Gerrits B., Panse C., Schlapbach R., Mansuy I.M.; Mol. Cell. Proteomics 6:283-293(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-75, AND MASSSPECTROMETRY. |