| UniProt ID | STX1B_MOUSE | |
|---|---|---|
| UniProt AC | P61264 | |
| Protein Name | Syntaxin-1B | |
| Gene Name | Stx1b | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 288 | |
| Subcellular Localization |
Membrane Single-pass type IV membrane protein . |
|
| Protein Description | Potentially involved in docking of synaptic vesicles at presynaptic active zones (By similarity). May mediate Ca(2+)-regulation of exocytosis acrosomal reaction in sperm.. | |
| Protein Sequence | MKDRTQELRSAKDSDDEEEVVHVDRDHFMDEFFEQVEEIRGCIEKLSEDVEQVKKQHSAILAAPNPDEKTKQELEDLTADIKKTANKVRSKLKAIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMTEYNATQSKYRDRCKDRIQRQLEITGRTTTNEELEDMLESGKLAIFTDDIKMDSQMTKQALNEIETRHNEIIKLETSIRELHDMFVDMAMLVESQGEMIDRIEYNVEHSVDYVERAVSDTKKAVKYQSKARRKKIMIIICCVVLGVVLASSIGGTLGL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 5 | Phosphorylation | ---MKDRTQELRSAK ---CCHHHHHHHHCC | 36.21 | 29899451 | |
| 10 | Phosphorylation | DRTQELRSAKDSDDE HHHHHHHHCCCCCCH | 52.90 | 25521595 | |
| 14 | Phosphorylation | ELRSAKDSDDEEEVV HHHHCCCCCCHHHEE | 46.37 | 25521595 | |
| 45 | Ubiquitination | EIRGCIEKLSEDVEQ HHHHHHHHHHHHHHH | 37.08 | 22790023 | |
| 50 | Ubiquitination | IEKLSEDVEQVKKQH HHHHHHHHHHHHHHH | 4.94 | 27667366 | |
| 54 | Ubiquitination | SEDVEQVKKQHSAIL HHHHHHHHHHHHHHH | 46.54 | 22790023 | |
| 55 | Ubiquitination | EDVEQVKKQHSAILA HHHHHHHHHHHHHHH | 55.15 | 22790023 | |
| 58 | Phosphorylation | EQVKKQHSAILAAPN HHHHHHHHHHHHCCC | 17.95 | 25521595 | |
| 65 | Ubiquitination | SAILAAPNPDEKTKQ HHHHHCCCCCHHHHH | 52.51 | 27667366 | |
| 69 | Ubiquitination | AAPNPDEKTKQELED HCCCCCHHHHHHHHH | 69.29 | 22790023 | |
| 71 | Ubiquitination | PNPDEKTKQELEDLT CCCCHHHHHHHHHHH | 53.49 | 22790023 | |
| 82 | Acetylation | EDLTADIKKTANKVR HHHHHHHHHHHHHHH | 44.62 | 8264491 | |
| 82 | Ubiquitination | EDLTADIKKTANKVR HHHHHHHHHHHHHHH | 44.62 | 22790023 | |
| 89 | Ubiquitination | KKTANKVRSKLKAIE HHHHHHHHHHHHHHH | 29.68 | 27667366 | |
| 93 | Ubiquitination | NKVRSKLKAIEQSIE HHHHHHHHHHHHHHH | 51.56 | 22790023 | |
| 98 | Phosphorylation | KLKAIEQSIEQEEGL HHHHHHHHHHHHHCC | 18.46 | 25521595 | |
| 108 | Phosphorylation | QEEGLNRSSADLRIR HHHCCCCCCHHHHHH | 28.89 | 29899451 | |
| 109 | Phosphorylation | EEGLNRSSADLRIRK HHCCCCCCHHHHHHH | 23.67 | 22817900 | |
| 125 | Ubiquitination | QHSTLSRKFVEVMTE HCCHHHHHHHHHHHH | 50.84 | 22790023 | |
| 136 | Phosphorylation | VMTEYNATQSKYRDR HHHHCCCCHHHHHHH | 29.72 | 29899451 | |
| 139 | Ubiquitination | EYNATQSKYRDRCKD HCCCCHHHHHHHHHH | 34.19 | 22790023 | |
| 155 | Phosphorylation | IQRQLEITGRTTTNE HHHHHHHHCCCCCHH | 15.96 | 24925903 | |
| 158 | Phosphorylation | QLEITGRTTTNEELE HHHHHCCCCCHHHHH | 39.04 | 22871156 | |
| 159 | Phosphorylation | LEITGRTTTNEELED HHHHCCCCCHHHHHH | 26.68 | 29899451 | |
| 160 | Phosphorylation | EITGRTTTNEELEDM HHHCCCCCHHHHHHH | 39.77 | 25521595 | |
| 170 | Phosphorylation | ELEDMLESGKLAIFT HHHHHHHHCCEEEEC | 36.95 | 29899451 | |
| 172 | Ubiquitination | EDMLESGKLAIFTDD HHHHHHCCEEEECCC | 43.98 | 22790023 | |
| 177 | Ubiquitination | SGKLAIFTDDIKMDS HCCEEEECCCCCCCH | 27.01 | 27667366 | |
| 181 | Ubiquitination | AIFTDDIKMDSQMTK EEECCCCCCCHHHHH | 43.58 | 22790023 | |
| 184 | Ubiquitination | TDDIKMDSQMTKQAL CCCCCCCHHHHHHHH | 20.53 | 27667366 | |
| 187 | Ubiquitination | IKMDSQMTKQALNEI CCCCHHHHHHHHHHH | 16.62 | 27667366 | |
| 188 | Ubiquitination | KMDSQMTKQALNEIE CCCHHHHHHHHHHHH | 28.38 | 22790023 | |
| 203 | Ubiquitination | TRHNEIIKLETSIRE HHHHHHHHHHHHHHH | 46.03 | 22790023 | |
| 206 | Phosphorylation | NEIIKLETSIRELHD HHHHHHHHHHHHHHH | 39.63 | 19854140 | |
| 211 | Ubiquitination | LETSIRELHDMFVDM HHHHHHHHHHHHHHH | 2.74 | 27667366 | |
| 224 | Phosphorylation | DMAMLVESQGEMIDR HHHHHHHCCCCEECE | 35.69 | 19854140 | |
| 248 | Ubiquitination | DYVERAVSDTKKAVK HHHHHHHHHHHHHHH | 38.28 | 27667366 | |
| 251 | Ubiquitination | ERAVSDTKKAVKYQS HHHHHHHHHHHHHHC | 43.66 | 27667366 | |
| 252 | Ubiquitination | RAVSDTKKAVKYQSK HHHHHHHHHHHHHCH | 61.58 | 27667366 | |
| 255 | Ubiquitination | SDTKKAVKYQSKARR HHHHHHHHHHCHHHH | 42.29 | 27667366 | |
| 299 | Ubiquitination | ------------------ ------------------ | 27667366 | ||
| 306 | Ubiquitination | ------------------------- ------------------------- | 27667366 | ||
| 370 | Ubiquitination | ----------------------------------------------------------------------------------------- ----------------------------------------------------------------------------------------- | 27667366 | ||
| 373 | Ubiquitination | -------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------- | 27667366 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of STX1B_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of STX1B_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of STX1B_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of STX1B_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Qualitative and quantitative analyses of protein phosphorylation innaive and stimulated mouse synaptosomal preparations."; Munton R.P., Tweedie-Cullen R., Livingstone-Zatchej M., Weinandy F.,Waidelich M., Longo D., Gehrig P., Potthast F., Rutishauser D.,Gerrits B., Panse C., Schlapbach R., Mansuy I.M.; Mol. Cell. Proteomics 6:283-293(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-14; SER-58 AND THR-160,AND MASS SPECTROMETRY. | |
| "Quantitative analysis of both protein expression and serine /threonine post-translational modifications through stable isotopelabeling with dithiothreitol."; Vosseller K., Hansen K.C., Chalkley R.J., Trinidad J.C., Wells L.,Hart G.W., Burlingame A.L.; Proteomics 5:388-398(2005). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-14, AND MASSSPECTROMETRY. | |