UniProt ID | GBB3_MOUSE | |
---|---|---|
UniProt AC | Q61011 | |
Protein Name | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 | |
Gene Name | Gnb3 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 340 | |
Subcellular Localization | ||
Protein Description | Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.. | |
Protein Sequence | MGEMEQLRQEAEQLKKQIADARKACADITLAELVSGLEVVGRVQMRTRRTLRGHLAKIYAMHWATDSKLLVSASQDGKLIVWDTYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNMCSIYNLKSREGNVKVSRELSAHTGYLSCCRFLDDNNIVTSSGDTTCALWDIETGQQKTVFVGHTGDCMSLAVSPDYKLFISGACDASAKLWDVREGTCRQTFTGHESDINAICFFPNGEAICTGSDDASCRLFDLRADQELTAYSQESIICGITSVAFSLSGRLLFAGYDDFNCNVWDSLKCERVGILSGHDNRVSCLGVTADGMAVATGSWDSFLKIWN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
50 | Phosphorylation | VQMRTRRTLRGHLAK EECCCCHHHHHHHHH | 19.95 | 25521595 | |
65 | Phosphorylation | IYAMHWATDSKLLVS HHHHHHHCCCCEEEE | 35.30 | 21454597 | |
67 | Phosphorylation | AMHWATDSKLLVSAS HHHHHCCCCEEEEEC | 22.35 | 21454597 | |
74 | Phosphorylation | SKLLVSASQDGKLIV CCEEEEECCCCCEEE | 22.69 | 21454597 | |
136 | Phosphorylation | REGNVKVSRELSAHT CCCCCEECHHHHCCC | 17.83 | - | |
177 | Ubiquitination | DIETGQQKTVFVGHT EECCCCEEEEEEECC | 38.48 | - | |
262 | Phosphorylation | LRADQELTAYSQESI ECCCCHHEEECCCEE | 23.85 | 25367039 | |
264 | Phosphorylation | ADQELTAYSQESIIC CCCHHEEECCCEEHH | 12.97 | 25367039 | |
265 | Phosphorylation | DQELTAYSQESIICG CCHHEEECCCEEHHC | 25.63 | 25367039 | |
268 | Phosphorylation | LTAYSQESIICGITS HEEECCCEEHHCHHH | 15.04 | 25367039 | |
274 | Phosphorylation | ESIICGITSVAFSLS CEEHHCHHHEEECCC | 11.48 | 25367039 | |
275 | Phosphorylation | SIICGITSVAFSLSG EEHHCHHHEEECCCC | 14.99 | 25367039 | |
279 | Phosphorylation | GITSVAFSLSGRLLF CHHHEEECCCCCEEE | 16.34 | 25367039 | |
281 | Phosphorylation | TSVAFSLSGRLLFAG HHEEECCCCCEEEEE | 22.22 | 25367039 | |
289 | Phosphorylation | GRLLFAGYDDFNCNV CCEEEEECCCCCCCC | 14.65 | 25367039 | |
299 | Phosphorylation | FNCNVWDSLKCERVG CCCCCHHHCCCEEEE | 17.64 | 25367039 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GBB3_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GBB3_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GBB3_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of GBB3_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Quantitative analysis of both protein expression and serine /threonine post-translational modifications through stable isotopelabeling with dithiothreitol."; Vosseller K., Hansen K.C., Chalkley R.J., Trinidad J.C., Wells L.,Hart G.W., Burlingame A.L.; Proteomics 5:388-398(2005). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-74, AND MASSSPECTROMETRY. |