UniProt ID | SYPH_MOUSE | |
---|---|---|
UniProt AC | Q62277 | |
Protein Name | Synaptophysin | |
Gene Name | Syp | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 314 | |
Subcellular Localization |
Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane Multi-pass membrane protein . Cell junction, synapse, synaptosome . |
|
Protein Description | Possibly involved in structural functions as organizing other membrane components or in targeting the vesicles to the plasma membrane (By similarity). Involved in the regulation of short-term and long-term synaptic plasticity.. | |
Protein Sequence | MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYTGELRLSVECANKTESALNIEVEFEYPFRLHQVYFDAPSCVKGGTTKIFLVGDYSSSAEFFVTVAVFAFLYSMGALATYIFLQNKYRENNKGPMMDFLATAVFAFMWLVSSSAWAKGLSDVKMATDPENIIKEMPMCRQTGNTCKELRDPVTSGLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFMRAPPGAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPASGGGGGYGPQGDYGQQGYGQQGAPTSFSNQM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
59 | N-linked_Glycosylation | RLSVECANKTESALN EEEEEECCCCCCCEE | 64.54 | - | |
81 | Phosphorylation | PFRLHQVYFDAPSCV CEEEEEEEECCCCCC | 6.81 | 25521595 | |
86 | Phosphorylation | QVYFDAPSCVKGGTT EEEECCCCCCCCCEE | 33.01 | 25521595 | |
87 | S-nitrosylation | VYFDAPSCVKGGTTK EEECCCCCCCCCEEE | 3.40 | 24895380 | |
89 | Ubiquitination | FDAPSCVKGGTTKIF ECCCCCCCCCEEEEE | 56.82 | - | |
169 | Ubiquitination | AKGLSDVKMATDPEN HCCCCCCEECCCHHH | 28.01 | 27667366 | |
187 | Phosphorylation | EMPMCRQTGNTCKEL HCCCCCCCCCCHHHH | 17.04 | 22324799 | |
190 | Phosphorylation | MCRQTGNTCKELRDP CCCCCCCCHHHHCCC | 26.71 | 22324799 | |
227 | Phosphorylation | LWFVFKETGWAAPFM HHHHHHCCCCCCCCC | 38.32 | - | |
269 | Phosphorylation | GYGPQDSYGPQGGYQ CCCCCCCCCCCCCCC | 40.91 | 22817900 | |
279 | Phosphorylation | QGGYQPDYGQPASGG CCCCCCCCCCCCCCC | 25.09 | 22817900 | |
296 | Phosphorylation | GYGPQGDYGQQGYGQ CCCCCCCCCCCCCCC | 24.53 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SYPH_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SYPH_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SYPH_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SYT1_MOUSE | Syt1 | physical | 21645620 | |
VAMP2_MOUSE | Vamp2 | physical | 21645620 | |
PARK7_MOUSE | Park7 | physical | 21645620 | |
VAMP2_MOUSE | Vamp2 | physical | 18706977 | |
SNG3_MOUSE | Syngr3 | physical | 18706977 | |
SCAM1_MOUSE | Scamp1 | physical | 18706977 | |
STMN3_MOUSE | Stmn3 | physical | 18706977 | |
RND2_MOUSE | Rnd2 | physical | 18706977 | |
ARFP2_MOUSE | Arfip2 | physical | 18706977 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Large-scale identification and evolution indexing of tyrosinephosphorylation sites from murine brain."; Ballif B.A., Carey G.R., Sunyaev S.R., Gygi S.P.; J. Proteome Res. 7:311-318(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-81, AND MASSSPECTROMETRY. |