UniProt ID | SNG3_MOUSE | |
---|---|---|
UniProt AC | Q8R191 | |
Protein Name | Synaptogyrin-3 {ECO:0000305} | |
Gene Name | Syngr3 {ECO:0000312|MGI:MGI:1341881} | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 229 | |
Subcellular Localization |
Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane Multi-pass membrane protein . Cell junction, synapse . Found at the neuromuscular synapses. |
|
Protein Description | May play a role in regulated exocytosis. [PubMed: 10383386 May indirectly regulate the activity of the plasma membrane dopamine transporter SLC6A3 and thereby regulate dopamine transport back from the synaptic cleft into the presynaptic terminal] | |
Protein Sequence | MEGASFGAGRAGAAFDPVSFARRPQTLLRVVSWVFSIAVFGPIVNEGYVNSDSGPELRCVFNGNAGACRFGVVLGLGAFIACVAFLLLDVRFQQISSVRDRRRAVLLDLGFSGVWSFLWFVGFCFLTNQWQRTTPGPGTAQAGDAARAAIAFSFFSILSWVALTVKALQRFRLGTDMSLFATDQLGTGAAQAYPGYPVGSGVEGTETYQSPPFTETLDTSSKGYQVPAY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MEGASFGA -------CCCCCCCC | 10.93 | - | |
5 | Phosphorylation | ---MEGASFGAGRAG ---CCCCCCCCCCCC | 34.76 | 18056256 | |
19 | Phosphorylation | GAAFDPVSFARRPQT CCCCCHHHHCCCHHH | 20.69 | 22817900 | |
134 | Phosphorylation | TNQWQRTTPGPGTAQ HCCCCCCCCCCCCCH | 28.56 | 25521595 | |
200 | Phosphorylation | YPGYPVGSGVEGTET CCCCCCCCCCCCCCC | 39.64 | 29899451 | |
208 | Phosphorylation | GVEGTETYQSPPFTE CCCCCCCCCCCCCCC | 10.76 | 29899451 | |
210 | Phosphorylation | EGTETYQSPPFTETL CCCCCCCCCCCCCCC | 24.91 | 29899451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SNG3_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SNG3_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SNG3_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SNG3_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...