SNG3_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SNG3_MOUSE
• UniProt AC: Q8R191
• Protein Name: Synaptogyrin-3 {ECO:0000305}
• Gene Name: Syngr3 {ECO:0000312|MGI:MGI:1341881}
• Organism: Mus musculus (Mouse).
• Sequence Length: 229
• Subcellular Localization: Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane ; Multi-pass membrane protein . Cell junction, synapse . Found at the neuromuscular synapses.
• Protein Description: May play a role in regulated exocytosis. [PubMed: 10383386 May indirectly regulate the activity of the plasma membrane dopamine transporter SLC6A3 and thereby regulate dopamine transport back from the synaptic cleft into the presynaptic terminal]
• Protein Sequence: MEGASFGAGRAGAAFDPVSFARRPQTLLRVVSWVFSIAVFGPIVNEGYVNSDSGPELRCVFNGNAGACRFGVVLGLGAFIACVAFLLLDVRFQQISSVRDRRRAVLLDLGFSGVWSFLWFVGFCFLTNQWQRTTPGPGTAQAGDAARAAIAFSFFSILSWVALTVKALQRFRLGTDMSLFATDQLGTGAAQAYPGYPVGSGVEGTETYQSPPFTETLDTSSKGYQVPAY

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MEGASFGA -------CCCCCCCC	10.93	-
5	Phosphorylation	---MEGASFGAGRAG ---CCCCCCCCCCCC	34.76	18056256
19	Phosphorylation	GAAFDPVSFARRPQT CCCCCHHHHCCCHHH	20.69	22817900
134	Phosphorylation	TNQWQRTTPGPGTAQ HCCCCCCCCCCCCCH	28.56	25521595
200	Phosphorylation	YPGYPVGSGVEGTET CCCCCCCCCCCCCCC	39.64	29899451
208	Phosphorylation	GVEGTETYQSPPFTE CCCCCCCCCCCCCCC	10.76	29899451
210	Phosphorylation	EGTETYQSPPFTETL CCCCCCCCCCCCCCC	24.91	29899451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SNG3_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SNG3_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SNG3_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of SNG3_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.