| UniProt ID | ARFP2_MOUSE | |
|---|---|---|
| UniProt AC | Q8K221 | |
| Protein Name | Arfaptin-2 | |
| Gene Name | Arfip2 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 341 | |
| Subcellular Localization | ||
| Protein Description | Putative target protein of ADP-ribosylation factor. Involved in membrane ruffling (By similarity).. | |
| Protein Sequence | MTDGILGKAATMEIPIHGNGEAGQLPEDDGLEQDLQQVMVSGPNLNETSIVSGGYGGSGDGLIPTGSGRHPSHSTSPSGPGDEVARGIAGEKFDIVKKWGINTYKCTKQLLSERFGRGSRTVDLELELQIELLRETKRKYESVLQLGRALTAHLYSLLQTQHALGDAFADLSQKSPELQEEFGYNAETQKLLCKNGETLLGAVNFFVSSINTLVTKTMEDTLMTVKQYEAARLEYDAYRTDLEELSLGPRDAGTRGRLESAQATFQTHRDKYEKLRGDVAIKLKFLEENKIKVMHKQLLLFHNAVSAYFAGNQKQLEQTLQQFNIKLRPPGAEKPSWLEEQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 72 | Phosphorylation | TGSGRHPSHSTSPSG CCCCCCCCCCCCCCC | 24.76 | 23684622 | |
| 74 | Phosphorylation | SGRHPSHSTSPSGPG CCCCCCCCCCCCCCC | 34.61 | 23684622 | |
| 75 | Phosphorylation | GRHPSHSTSPSGPGD CCCCCCCCCCCCCCH | 38.95 | 30635358 | |
| 76 | Phosphorylation | RHPSHSTSPSGPGDE CCCCCCCCCCCCCHH | 21.78 | 26824392 | |
| 78 | Phosphorylation | PSHSTSPSGPGDEVA CCCCCCCCCCCHHHH | 58.34 | 25159016 | |
| 97 | Acetylation | GEKFDIVKKWGINTY CCCHHHHHHHCCCHH | 43.04 | 24062335 | |
| 112 | Phosphorylation | KCTKQLLSERFGRGS HHHHHHHHHHHCCCC | 35.01 | 22817900 | |
| 221 | Phosphorylation | VTKTMEDTLMTVKQY HCCCHHHHCHHHHHH | 12.72 | 25195567 | |
| 226 | Ubiquitination | EDTLMTVKQYEAARL HHHCHHHHHHHHHHC | 37.69 | 22790023 | |
| 260 | Phosphorylation | GTRGRLESAQATFQT CCCHHHHHHHHHHHH | 30.21 | 28066266 | |
| 290 | Ubiquitination | LKFLEENKIKVMHKQ HHHHHHCCCCCHHHH | 47.38 | 22790023 | |
| 336 | Phosphorylation | PPGAEKPSWLEEQ-- CCCCCCCCHHHCC-- | 56.19 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARFP2_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARFP2_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARFP2_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of ARFP2_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
