UniProt ID | ARFP2_MOUSE | |
---|---|---|
UniProt AC | Q8K221 | |
Protein Name | Arfaptin-2 | |
Gene Name | Arfip2 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 341 | |
Subcellular Localization | ||
Protein Description | Putative target protein of ADP-ribosylation factor. Involved in membrane ruffling (By similarity).. | |
Protein Sequence | MTDGILGKAATMEIPIHGNGEAGQLPEDDGLEQDLQQVMVSGPNLNETSIVSGGYGGSGDGLIPTGSGRHPSHSTSPSGPGDEVARGIAGEKFDIVKKWGINTYKCTKQLLSERFGRGSRTVDLELELQIELLRETKRKYESVLQLGRALTAHLYSLLQTQHALGDAFADLSQKSPELQEEFGYNAETQKLLCKNGETLLGAVNFFVSSINTLVTKTMEDTLMTVKQYEAARLEYDAYRTDLEELSLGPRDAGTRGRLESAQATFQTHRDKYEKLRGDVAIKLKFLEENKIKVMHKQLLLFHNAVSAYFAGNQKQLEQTLQQFNIKLRPPGAEKPSWLEEQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
72 | Phosphorylation | TGSGRHPSHSTSPSG CCCCCCCCCCCCCCC | 24.76 | 23684622 | |
74 | Phosphorylation | SGRHPSHSTSPSGPG CCCCCCCCCCCCCCC | 34.61 | 23684622 | |
75 | Phosphorylation | GRHPSHSTSPSGPGD CCCCCCCCCCCCCCH | 38.95 | 30635358 | |
76 | Phosphorylation | RHPSHSTSPSGPGDE CCCCCCCCCCCCCHH | 21.78 | 26824392 | |
78 | Phosphorylation | PSHSTSPSGPGDEVA CCCCCCCCCCCHHHH | 58.34 | 25159016 | |
97 | Acetylation | GEKFDIVKKWGINTY CCCHHHHHHHCCCHH | 43.04 | 24062335 | |
112 | Phosphorylation | KCTKQLLSERFGRGS HHHHHHHHHHHCCCC | 35.01 | 22817900 | |
221 | Phosphorylation | VTKTMEDTLMTVKQY HCCCHHHHCHHHHHH | 12.72 | 25195567 | |
226 | Ubiquitination | EDTLMTVKQYEAARL HHHCHHHHHHHHHHC | 37.69 | 22790023 | |
260 | Phosphorylation | GTRGRLESAQATFQT CCCHHHHHHHHHHHH | 30.21 | 28066266 | |
290 | Ubiquitination | LKFLEENKIKVMHKQ HHHHHHCCCCCHHHH | 47.38 | 22790023 | |
336 | Phosphorylation | PPGAEKPSWLEEQ-- CCCCCCCCHHHCC-- | 56.19 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARFP2_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARFP2_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARFP2_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ARFP2_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...