| UniProt ID | VA0D1_MOUSE | |
|---|---|---|
| UniProt AC | P51863 | |
| Protein Name | V-type proton ATPase subunit d 1 | |
| Gene Name | Atp6v0d1 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 351 | |
| Subcellular Localization |
Membrane Peripheral membrane protein Cytoplasmic side . Localizes to centrosome and the base of the cilium.. |
|
| Protein Description | Subunit of the integral membrane V0 complex of vacuolar ATPase. Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system. May play a role in coupling of proton transport and ATP hydrolysis. May play a role in cilium biogenesis through regulation of the transport and the localization of proteins to the cilium (By similarity). In aerobic conditions, involved in intracellular iron homeostasis, thus triggering the activity of Fe(2+) prolyl hydroxylase (PHD) enzymes, and leading to HIF1A hydroxylation and subsequent proteasomal degradation (By similarity).. | |
| Protein Sequence | MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVIDDKLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 24 | Ubiquitination | EGLVRGLKAGVLSQA HHHHHHHHHCCCCHH | 46.01 | - | |
| 39 | Glutathionylation | DYLNLVQCETLEDLK HHHCCEECCCHHHHH | 3.17 | 24333276 | |
| 39 | S-palmitoylation | DYLNLVQCETLEDLK HHHCCEECCCHHHHH | 3.17 | 28680068 | |
| 51 | Phosphorylation | DLKLHLQSTDYGNFL HHHHHHHCCCHHHHH | 29.61 | 29899451 | |
| 63 | Phosphorylation | NFLANEASPLTVSVI HHHCCCCCCCEEEEE | 17.79 | 29899451 | |
| 66 | Phosphorylation | ANEASPLTVSVIDDK CCCCCCCEEEEECHH | 17.70 | 29899451 | |
| 68 | Phosphorylation | EASPLTVSVIDDKLK CCCCCEEEEECHHHH | 14.23 | 29899451 | |
| 73 | Ubiquitination | TVSVIDDKLKEKMVV EEEEECHHHHHHHHE | 58.68 | 22790023 | |
| 121 | Phosphorylation | TGTLHQRSIAELVPK HCCCCHHCHHHHCCC | 21.41 | 22817900 | |
| 187 | Ubiquitination | IIRNTLYKAYLESFY HHHHHHHHHHHHHHH | 33.40 | 22790023 | |
| 197 | S-palmitoylation | LESFYKFCTLLGGTT HHHHHHHHHHHCCCC | 1.99 | 28680068 | |
| 248 | Phosphorylation | FPHCGRLYPEGLAQL CCCCCCCCHHHHHHH | 9.62 | 22324799 | |
| 265 | Ubiquitination | ADDYEQVKNVADYYP CCCHHHHHCHHHHCH | 45.45 | 22790023 | |
| 270 | Phosphorylation | QVKNVADYYPEYKLL HHHCHHHHCHHHHHH | 15.93 | 22817900 | |
| 275 | Ubiquitination | ADYYPEYKLLFEGAG HHHCHHHHHHHCCCC | 36.73 | 22790023 | |
| 283 | Phosphorylation | LLFEGAGSNPGDKTL HHHCCCCCCCCCCCH | 39.04 | 25521595 | |
| 288 | Ubiquitination | AGSNPGDKTLEDRFF CCCCCCCCCHHHHHH | 62.01 | 22790023 | |
| 335 | Glutathionylation | NIVWIAECIAQRHRA HHHHHHHHHHHHHHH | 2.00 | 24333276 | |
| 335 | S-palmitoylation | NIVWIAECIAQRHRA HHHHHHHHHHHHHHH | 2.00 | 28526873 | |
| 343 | Ubiquitination | IAQRHRAKIDNYIPI HHHHHHHHHHCCCCC | 51.02 | 22790023 | |
| 347 | Phosphorylation | HRAKIDNYIPIF--- HHHHHHCCCCCC--- | 12.34 | 29514104 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VA0D1_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VA0D1_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VA0D1_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of VA0D1_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Qualitative and quantitative analyses of protein phosphorylation innaive and stimulated mouse synaptosomal preparations."; Munton R.P., Tweedie-Cullen R., Livingstone-Zatchej M., Weinandy F.,Waidelich M., Longo D., Gehrig P., Potthast F., Rutishauser D.,Gerrits B., Panse C., Schlapbach R., Mansuy I.M.; Mol. Cell. Proteomics 6:283-293(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-283, AND MASSSPECTROMETRY. | |
| "Large-scale identification and evolution indexing of tyrosinephosphorylation sites from murine brain."; Ballif B.A., Carey G.R., Sunyaev S.R., Gygi S.P.; J. Proteome Res. 7:311-318(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-270, AND MASSSPECTROMETRY. | |
