UniProt ID | TR13B_HUMAN | |
---|---|---|
UniProt AC | O14836 | |
Protein Name | Tumor necrosis factor receptor superfamily member 13B | |
Gene Name | TNFRSF13B | |
Organism | Homo sapiens (Human). | |
Sequence Length | 293 | |
Subcellular Localization |
Membrane Single-pass type III membrane protein. |
|
Protein Description | Receptor for TNFSF13/APRIL and TNFSF13B/TALL1/BAFF/BLYS that binds both ligands with similar high affinity. Mediates calcineurin-dependent activation of NF-AT, as well as activation of NF-kappa-B and AP-1. Involved in the stimulation of B- and T-cell function and the regulation of humoral immunity.. | |
Protein Sequence | MSGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRRQRSGEVENNSDNSGRYQGLEHRGSEASPALPGLKLSADQVALVYSTLGLCLCAVLCCFLVAVACFLKKRGDPCSCQPRSRPRQSPAKSSQDHAMEAGSPVSTSPEPVETCSFCFPECRAPTQESAVTPGTPDPTCAGRWGCHTRTTVLQPCPHIPDSGLGIVCVPAQEGGPGA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
110 | Phosphorylation | FCENKLRSPVNLPPE HCCCCCCCCCCCCHH | 43.57 | - | |
128 | N-linked_Glycosylation | QRSGEVENNSDNSGR HHCCCCCCCCCCCCC | 59.49 | UniProtKB CARBOHYD | |
207 | Ubiquitination | RPRQSPAKSSQDHAM CCCCCCCCCHHHCHH | 54.76 | - | |
209 | Phosphorylation | RQSPAKSSQDHAMEA CCCCCCCHHHCHHHC | 38.63 | 30108239 | |
218 | Phosphorylation | DHAMEAGSPVSTSPE HCHHHCCCCCCCCCC | 29.22 | 30108239 | |
221 | Phosphorylation | MEAGSPVSTSPEPVE HHCCCCCCCCCCCCC | 26.93 | 30108239 | |
222 | Phosphorylation | EAGSPVSTSPEPVET HCCCCCCCCCCCCCC | 48.84 | 30108239 | |
223 | Phosphorylation | AGSPVSTSPEPVETC CCCCCCCCCCCCCCC | 21.54 | 30108239 | |
229 | Phosphorylation | TSPEPVETCSFCFPE CCCCCCCCCCCCCCC | 17.43 | 30108239 | |
231 | Phosphorylation | PEPVETCSFCFPECR CCCCCCCCCCCCCCC | 32.25 | 30108239 | |
247 | Phosphorylation | PTQESAVTPGTPDPT CCCCCCCCCCCCCCC | 18.73 | 30108239 | |
250 | Phosphorylation | ESAVTPGTPDPTCAG CCCCCCCCCCCCCCC | 26.23 | 28674151 | |
254 | Phosphorylation | TPGTPDPTCAGRWGC CCCCCCCCCCCCCCC | 23.51 | 30108239 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TR13B_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TR13B_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TR13B_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...