UniProt ID | MCFS1_YEAST | |
---|---|---|
UniProt AC | Q02891 | |
Protein Name | Medium-chain fatty acid ethyl ester synthase/esterase 1 | |
Gene Name | EEB1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 456 | |
Subcellular Localization | ||
Protein Description | Displays enzymatic activity both for medium-chain fatty acid (MCFA) ethyl ester synthesis and hydrolysis (esterase activity). MCFA are toxic for yeast and this enzyme could thus be involved in their detoxification by esterification.. | |
Protein Sequence | MFRSGYYPTVTPSHWGYNGTVKHVLGEKGTKSLAFRDSKRQIPLHEFVTKHVPTLKDGANFRLNSLLFTGYLQTLYLSAGDFSKKFQVFYGREIIKFSDGGVCTADWVMPEWEQTYSLNAEKASFNEKQFSNDEKATHPKGWPRLHPRTRYLSSEELEKCHSKGYSYPLVVVLHGLAGGSHEPLIRALSEDLSKVGDGKFQVVVLNARGCSRSKVTTRRIFTALHTGDVREFLNHQKALFPQRKIYAVGTSFGAAMLTNYLGEEGDNCPLNAAVALSNPWDFVHTWDKLAHDWWSNHIFSRTLTQFLTRTVKVNMNELQVPENFEVSHKPTVEKPVFYTYTRENLEKAEKFTDILEFDNLFTAPSMGLPDGLTYYRKASSINRLPNIKIPTLIINATDDPVTGENVIPYKQARENPCVLLCETDLGGHLAYLDNESNSWLTKQAAEFLGSFDELVL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
22 | Ubiquitination | WGYNGTVKHVLGEKG CCCCCCEEECCCCCC | 28.03 | 17644757 | |
28 | Ubiquitination | VKHVLGEKGTKSLAF EEECCCCCCCCEEEE | 70.81 | 23749301 | |
31 | Ubiquitination | VLGEKGTKSLAFRDS CCCCCCCCEEEECCC | 52.74 | 17644757 | |
39 | Ubiquitination | SLAFRDSKRQIPLHE EEEECCCCCCCCHHH | 53.24 | 17644757 | |
50 | Ubiquitination | PLHEFVTKHVPTLKD CHHHHHHHCCCCCCC | 36.98 | 17644757 | |
54 | Phosphorylation | FVTKHVPTLKDGANF HHHHCCCCCCCCCCE | 45.40 | 27017623 | |
84 | Ubiquitination | LSAGDFSKKFQVFYG ECCCCHHHHEEEEEC | 58.56 | 17644757 | |
85 | Ubiquitination | SAGDFSKKFQVFYGR CCCCHHHHEEEEECC | 39.57 | 17644757 | |
128 | Ubiquitination | EKASFNEKQFSNDEK HHHCCCHHHCCCCCC | 58.72 | 23749301 | |
159 | Ubiquitination | LSSEELEKCHSKGYS CCHHHHHHHHHCCCC | 50.28 | 17644757 | |
163 | Ubiquitination | ELEKCHSKGYSYPLV HHHHHHHCCCCCCEE | 37.90 | 17644757 | |
194 | Ubiquitination | ALSEDLSKVGDGKFQ HHHHHHHHHCCCCEE | 58.49 | 17644757 | |
199 | Ubiquitination | LSKVGDGKFQVVVLN HHHHCCCCEEEEEEE | 37.05 | 23749301 | |
237 | Ubiquitination | REFLNHQKALFPQRK HHHHHHCHHHCCCCC | 39.23 | 17644757 | |
288 | Ubiquitination | DFVHTWDKLAHDWWS HHHHHHHHHHHHHHH | 38.85 | 17644757 | |
312 | Ubiquitination | QFLTRTVKVNMNELQ HHHHCEEECCCCCCC | 27.55 | 17644757 | |
329 | Ubiquitination | ENFEVSHKPTVEKPV CCEECCCCCCCCCCE | 34.57 | 17644757 | |
334 | Ubiquitination | SHKPTVEKPVFYTYT CCCCCCCCCEEEEEE | 41.99 | 17644757 | |
350 | Ubiquitination | ENLEKAEKFTDILEF HHHHHHHHHCHHHHC | 59.43 | 17644757 | |
377 | Ubiquitination | DGLTYYRKASSINRL CCCEEEEECHHCCCC | 36.18 | 17644757 | |
388 | Ubiquitination | INRLPNIKIPTLIIN CCCCCCCCCCEEEEE | 49.63 | 17644757 | |
410 | Ubiquitination | GENVIPYKQARENPC CCCCCCHHHHCCCCE | 31.93 | 17644757 | |
442 | Ubiquitination | ESNSWLTKQAAEFLG CCCCHHHHHHHHHHC | 35.45 | 17644757 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MCFS1_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MCFS1_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MCFS1_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...