dbPTM

ASP21_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ASP21_YEAST
UniProt AC	P0CZ17
Protein Name	L-asparaginase 2-1
Gene Name	ASP3-1
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	362
Subcellular Localization	Secreted. Periplasm.
Protein Description
Protein Sequence	MRSLNTLLLSLFVAMSSGAPLLKIREEKNSSLPSIKIFGTGGTIASKGSTSATTAGYSVGLTVNDLIEAVPSLAEKANLDYLQVSNVGSNSLNYTHLIPLYHGISEALASDDYAGAVVTHGTDTMEETAFFLDLTINSEKPVCIAGAMRPATATSADGPMNLYQAVSIAASEKSLGRGTMITLNDRIASGFWTTKMNANSLDTFRADEQGYLGYFSNDDVEFYYPPVKPNGWQFFDISNLTDPSEIPEVIILYSYQGLNPELIVKAVKDLGAKGIVLAGSGAGSWTATGSIVNEQLYEEYGIPIVHSRRTADGTVPPDDAPEYAIGSGYLNPQKSRILLQLCLYSGYGMDQIRSVFSGVYGG

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
29	N-linked_Glycosylation	LKIREEKNSSLPSIK CHHHHHCCCCCCCEE	39.86	-
93	N-linked_Glycosylation	NVGSNSLNYTHLIPL CCCCCCCCCEEEEEC	39.20	-
239	N-linked_Glycosylation	WQFFDISNLTDPSEI EEEEECCCCCCHHHC	47.49	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ASP21_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ASP21_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ASP21_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SBA1_YEAST	SBA1	physical	18719252
PDX3_YEAST	PDX3	genetic	21623372
ADH3_YEAST	ADH3	genetic	21623372
CBS_YEAST	CYS4	genetic	21623372
QCR7_YEAST	QCR7	genetic	21623372
6PGD1_YEAST	GND1	genetic	21623372
GLO4_YEAST	GLO4	genetic	21623372
CHO2_YEAST	CHO2	genetic	21623372
FOLE_YEAST	MET7	genetic	21623372
6PGD2_YEAST	GND2	genetic	21623372
TAL2_YEAST	NQM1	genetic	21623372
SERA_YEAST	SER3	genetic	21623372
NDH1_YEAST	NDE1	genetic	21623372
PLB2_YEAST	PLB2	genetic	21623372
CND2_YEAST	BRN1	genetic	27708008
RMRP_YEAST	SNM1	genetic	27708008
DPOD2_YEAST	POL31	genetic	27708008
RPN5_YEAST	RPN5	genetic	27708008
GLE1_YEAST	GLE1	genetic	27708008
PDC2_YEAST	PDC2	genetic	27708008
CDC4_YEAST	CDC4	genetic	27708008
PSA1_YEAST	SCL1	genetic	27708008
CDC20_YEAST	CDC20	genetic	27708008
CBF3B_YEAST	CEP3	genetic	27708008
LCB1_YEAST	LCB1	genetic	27708008
TYSY_YEAST	CDC21	genetic	27708008
SMP3_YEAST	SMP3	genetic	27708008
DYR_YEAST	DFR1	genetic	27708008
TBF1_YEAST	TBF1	genetic	27708008
SYLC_YEAST	CDC60	genetic	27708008
SYH_YEAST	HTS1	genetic	27708008
PSB5_YEAST	PRE2	genetic	27708008
PAT1_YEAST	PAT1	genetic	27708008
YCZ2_YEAST	YCR102C	genetic	27708008
SOK1_YEAST	SOK1	genetic	27708008
YLL53_YEAST	YLL053C	genetic	27708008
TAL1_YEAST	TAL1	genetic	27708008
SGS1_YEAST	SGS1	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ASP21_YEAST

Related Literatures of Post-Translational Modification