UniProt ID | WBP1_HUMAN | |
---|---|---|
UniProt AC | Q96G27 | |
Protein Name | WW domain-binding protein 1 | |
Gene Name | WBP1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 269 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MARASSGNGSEEAWGALRAPQQQLRELCPGVNNQPYLCESGHCCGETGCCTYYYELWWFWLLWTVLILFSCCCAFRHRRAKLRLQQQQRQREINLLAYHGACHGAGPFPTGSLLDLRFLSTFKPPAYEDVVHRPGTPPPPYTVAPGRPLTASSEQTCCSSSSSCPAHFEGTNVEGVSSHQSAPPHQEGEPGAGVTPASTPPSCRYRRLTGDSGIELCPCPASGEGEPVKEVRVSATLPDLEDYSPCALPPESVPQIFPMGLSSSEGDIP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
110 | Phosphorylation | HGAGPFPTGSLLDLR CCCCCCCCCCCCHHH | 39.52 | 24719451 | |
112 | Phosphorylation | AGPFPTGSLLDLRFL CCCCCCCCCCHHHHH | 28.39 | 28348404 | |
136 | Phosphorylation | DVVHRPGTPPPPYTV CCCCCCCCCCCCCCC | 34.99 | - | |
209 | Phosphorylation | SCRYRRLTGDSGIEL CCCCCCCCCCCCCEE | 36.81 | 23401153 | |
212 | Phosphorylation | YRRLTGDSGIELCPC CCCCCCCCCCEEECC | 42.91 | 29978859 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of WBP1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of WBP1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of WBP1_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...