| UniProt ID | CIAO1_HUMAN | |
|---|---|---|
| UniProt AC | O76071 | |
| Protein Name | Probable cytosolic iron-sulfur protein assembly protein CIAO1 {ECO:0000255|HAMAP-Rule:MF_03037} | |
| Gene Name | CIAO1 {ECO:0000255|HAMAP-Rule:MF_03037} | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 339 | |
| Subcellular Localization | ||
| Protein Description | Key component of the cytosolic iron-sulfur protein assembly (CIA) complex, a multiprotein complex that mediates the incorporation of iron-sulfur cluster into extramitochondrial Fe/S proteins. Seems to specifically modulate the transactivation activity of WT1. As part of the mitotic spindle-associated MMXD complex it may play a role in chromosome segregation.. | |
| Protein Sequence | MKDSLVLLGRVPAHPDSRCWFLAWNPAGTLLASCGGDRRIRIWGTEGDSWICKSVLSEGHQRTVRKVAWSPCGNYLASASFDATTCIWKKNQDDFECVTTLEGHENEVKSVAWAPSGNLLATCSRDKSVWVWEVDEEDEYECVSVLNSHTQDVKHVVWHPSQELLASASYDDTVKLYREEEDDWVCCATLEGHESTVWSLAFDPSGQRLASCSDDRTVRIWRQYLPGNEQGVACSGSDPSWKCICTLSGFHSRTIYDIAWCQLTGALATACGDDAIRVFQEDPNSDPQQPTFSLTAHLHQAHSQDVNCVAWNPKEPGLLASCSDDGEVAFWKYQRPEGL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Sulfoxidation | -------MKDSLVLL -------CCCEEEEE | 11.11 | 21406390 | |
| 2 | Ubiquitination | ------MKDSLVLLG ------CCCEEEEEC | 56.90 | 23000965 | |
| 4 | Phosphorylation | ----MKDSLVLLGRV ----CCCEEEEECCC | 18.17 | 20068231 | |
| 41 | Methylation | CGGDRRIRIWGTEGD CCCCCEEEEEECCCC | 19.45 | - | |
| 53 | Ubiquitination | EGDSWICKSVLSEGH CCCCCCHHHHCCCCC | 34.17 | 22817900 | |
| 57 | Phosphorylation | WICKSVLSEGHQRTV CCHHHHCCCCCCCCE | 39.10 | 25159151 | |
| 90 | Ubiquitination | ATTCIWKKNQDDFEC CEEEEEECCCCCCEE | 44.86 | 29967540 | |
| 109 | Ubiquitination | EGHENEVKSVAWAPS ECCCCEEEEEEECCC | 32.79 | 21963094 | |
| 161 | Phosphorylation | KHVVWHPSQELLASA EEEEECCCHHHHHCC | 24.33 | 28450419 | |
| 167 | Phosphorylation | PSQELLASASYDDTV CCHHHHHCCCCCCCE | 20.09 | 20873877 | |
| 169 | Phosphorylation | QELLASASYDDTVKL HHHHHCCCCCCCEEE | 26.97 | 20873877 | |
| 170 | Phosphorylation | ELLASASYDDTVKLY HHHHCCCCCCCEEEE | 19.97 | 20873877 | |
| 173 | Phosphorylation | ASASYDDTVKLYREE HCCCCCCCEEEEECC | 19.35 | 20873877 | |
| 235 | Phosphorylation | NEQGVACSGSDPSWK CCCCEECCCCCCCCE | 31.43 | 28985074 | |
| 242 | Ubiquitination | SGSDPSWKCICTLSG CCCCCCCEEEEEECC | 20.33 | 21963094 | |
| 321 | Phosphorylation | KEPGLLASCSDDGEV CCCCCEEEECCCCCE | 17.70 | 20873877 | |
| 323 | Phosphorylation | PGLLASCSDDGEVAF CCCEEEECCCCCEEE | 35.92 | 20873877 | |
| 332 | Ubiquitination | DGEVAFWKYQRPEGL CCCEEEEEECCCCCC | 25.67 | 21963094 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CIAO1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CIAO1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CIAO1_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
