YAED1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YAED1_HUMAN
• UniProt AC: Q9NRH1
• Protein Name: Yae1 domain-containing protein 1
• Gene Name: YAE1D1
• Organism: Homo sapiens (Human).
• Sequence Length: 226
• Protein Sequence: MSWVQAASLIQGPGDKGDVFDEEADESLLAQREWQSNMQRRVKEGYRDGIDAGKAVTLQQGFNQGYKKGAEVILNYGRLRGTLSALLSWCHLHNNNSTLINKINNLLDAVGQCEEYVLKHLKSITPPSHVVDLLDSIEDMDLCHVVPAEKKIDEAKDERLCENNAEFNKNCSKSHSGIDCSYVECCRTQEHAHSENPSPTWILEQTASLVKQLGLSVDVLQHLKQL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of YAED1_HUMAN !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YAED1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YAED1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YAED1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
VIME_HUMAN	VIM	physical	16169070
CHD3_HUMAN	CHD3	physical	16169070
CE126_HUMAN	KIAA1377	physical	16169070
ROA2_HUMAN	HNRNPA2B1	physical	21900206
NAT14_HUMAN	NAT14	physical	21900206
ZN579_HUMAN	ZNF579	physical	21900206
CHD3_HUMAN	CHD3	physical	21900206
MCF2L_HUMAN	MCF2L	physical	21900206
KAIN_HUMAN	SERPINA4	physical	21900206
HAUS5_HUMAN	HAUS5	physical	21900206
BBS10_HUMAN	BBS10	physical	21900206
VIME_HUMAN	VIM	physical	21900206
CE126_HUMAN	KIAA1377	physical	21900206
NACAD_HUMAN	NACAD	physical	21900206
DPYL1_HUMAN	CRMP1	physical	21900206
MET18_HUMAN	METTL18	physical	21900206
S2533_HUMAN	SLC25A33	physical	21900206
A4_HUMAN	APP	physical	21832049
ORAV1_HUMAN	ORAOV1	physical	23318452

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.