UniProt ID | FA96A_HUMAN | |
---|---|---|
UniProt AC | Q9H5X1 | |
Protein Name | MIP18 family protein FAM96A | |
Gene Name | FAM96A | |
Organism | Homo sapiens (Human). | |
Sequence Length | 160 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | May play a role in chromosome segregation through establishment of sister chromatid cohesion.. | |
Protein Sequence | MQRVSGLLSWTLSRVLWLSGLSEPGAARQPRIMEEKALEVYDLIRTIRDPEKPNTLEELEVVSESCVEVQEINEEEYLVIIRFTPTVPHCSLATLIGLCLRVKLQRCLPFKHKLEIYISEGTHSTEEDINKQINDKERVAAAMENPNLREIVEQCVLEPD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of FA96A_HUMAN !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FA96A_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FA96A_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FA96A_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CIAO1_HUMAN | CIAO1 | physical | 23891004 | |
IREB2_HUMAN | IREB2 | physical | 23891004 | |
PRPS2_HUMAN | PRPS2 | physical | 23891004 | |
MYH11_HUMAN | MYH11 | physical | 23891004 | |
TDRD3_HUMAN | TDRD3 | physical | 23891004 | |
DNJB6_HUMAN | DNAJB6 | physical | 23891004 | |
DPOE1_HUMAN | POLE | physical | 23891004 | |
MLF2_HUMAN | MLF2 | physical | 23891004 | |
NARFL_HUMAN | NARFL | physical | 23891004 | |
TOP3B_HUMAN | TOP3B | physical | 23891004 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...