FA96A_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: FA96A_HUMAN
• UniProt AC: Q9H5X1
• Protein Name: MIP18 family protein FAM96A
• Gene Name: FAM96A
• Organism: Homo sapiens (Human).
• Sequence Length: 160
• Subcellular Localization: Cytoplasm .
• Protein Description: May play a role in chromosome segregation through establishment of sister chromatid cohesion..
• Protein Sequence: MQRVSGLLSWTLSRVLWLSGLSEPGAARQPRIMEEKALEVYDLIRTIRDPEKPNTLEELEVVSESCVEVQEINEEEYLVIIRFTPTVPHCSLATLIGLCLRVKLQRCLPFKHKLEIYISEGTHSTEEDINKQINDKERVAAAMENPNLREIVEQCVLEPD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of FA96A_HUMAN !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of FA96A_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of FA96A_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of FA96A_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CIAO1_HUMAN	CIAO1	physical	23891004
IREB2_HUMAN	IREB2	physical	23891004
PRPS2_HUMAN	PRPS2	physical	23891004
MYH11_HUMAN	MYH11	physical	23891004
TDRD3_HUMAN	TDRD3	physical	23891004
DNJB6_HUMAN	DNAJB6	physical	23891004
DPOE1_HUMAN	POLE	physical	23891004
MLF2_HUMAN	MLF2	physical	23891004
NARFL_HUMAN	NARFL	physical	23891004
TOP3B_HUMAN	TOP3B	physical	23891004

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.