UniProt ID | SYNCI_HUMAN | |
---|---|---|
UniProt AC | Q9H7C4 | |
Protein Name | Syncoilin | |
Gene Name | SYNC | |
Organism | Homo sapiens (Human). | |
Sequence Length | 482 | |
Subcellular Localization | Cytoplasm, perinuclear region . In skeletal muscle, colocalizes with DES and DTNA, and is localized at the myotendinous and neuromuscular junctions, sarcolemma and Z-lines. In myotubes, detected in a punctate cytoplasmic pattern (By similarity). | |
Protein Description | Atypical type III intermediate filament (IF) protein that may play a supportive role in the efficient coupling of mechanical stress between the myofibril and fiber exterior. May facilitate lateral force transmission during skeletal muscle contraction. Does not form homofilaments nor heterofilaments with other IF proteins.. | |
Protein Sequence | MASPEPRRGGDGAAQAARKTRVEANSPLPKNSGSLNEAEALNPEVTLSSEGSLNLEDILYLEDTGDLDETLYVQETEKAEEALYIEEAMQPDEALHVEEPGNPEETVCVEETTEPDRIQFVEGPVEPGKPTSPEHVVYEGETVTRAEKSNPEESLRAEQSPSMEENLSIEDLELLEGRFQQCVQAVAQLEEERDQLIHELVLLREPALQEVQQVHQDILAAYKLHAQAELERDGLREEIRLVKQKLFKVTKECVAYQYQLECRQQDVAQFADFREVLTTRATQLSEELAQLRDAYQKQKEQLRQQLEAPPSQRDGHFLQESRRLSAQFENLMAESRQDLEEEYEPQFLRLLERKEAGTKALQRTQAEIQEMKEALRPLQAEARQLRLQNRNLEDQIALVRQKRDEEVQQYREQLEEMEERQRQLRNGVQLQQQKNKEMEQLRLSLAEELSTYKAMLLPKSLEQADAPTSQAGGMETQSQGAV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
20 | Phosphorylation | AAQAARKTRVEANSP HHHHHHHHCCCCCCC | 34.10 | 23403867 | |
26 | Phosphorylation | KTRVEANSPLPKNSG HHCCCCCCCCCCCCC | 34.56 | 25159151 | |
34 | Phosphorylation | PLPKNSGSLNEAEAL CCCCCCCCCCHHHHH | 28.04 | - | |
131 | Phosphorylation | PVEPGKPTSPEHVVY CCCCCCCCCCCEEEE | 61.47 | 22167270 | |
132 | Phosphorylation | VEPGKPTSPEHVVYE CCCCCCCCCCEEEEE | 36.50 | 22167270 | |
138 | Phosphorylation | TSPEHVVYEGETVTR CCCCEEEEECEECEE | 19.68 | 27642862 | |
142 | Phosphorylation | HVVYEGETVTRAEKS EEEEECEECEEHHHC | 37.73 | 20068231 | |
144 | Phosphorylation | VYEGETVTRAEKSNP EEECEECEEHHHCCH | 31.42 | 20068231 | |
325 | Phosphorylation | LQESRRLSAQFENLM HHHHHHHHHHHHHHH | 20.43 | 22167270 | |
335 | Phosphorylation | FENLMAESRQDLEEE HHHHHHHHHHHHHHH | 26.21 | 22617229 | |
343 | Phosphorylation | RQDLEEEYEPQFLRL HHHHHHHHCHHHHHH | 35.87 | 27642862 | |
450 | Phosphorylation | LSLAEELSTYKAMLL HHHHHHHHHHHHHHC | 32.73 | 26074081 | |
451 | Phosphorylation | SLAEELSTYKAMLLP HHHHHHHHHHHHHCC | 41.48 | 26074081 | |
452 | Phosphorylation | LAEELSTYKAMLLPK HHHHHHHHHHHHCCC | 8.06 | 26074081 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SYNCI_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SYNCI_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SYNCI_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...