UniProt ID | MZT1_HUMAN | |
---|---|---|
UniProt AC | Q08AG7 | |
Protein Name | Mitotic-spindle organizing protein 1 | |
Gene Name | MZT1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 82 | |
Subcellular Localization | Cytoplasm, cytoskeleton, microtubule organizing center, centrosome . Cytoplasm, cytoskeleton, spindle . | |
Protein Description | Required for gamma-tubulin complex recruitment to the centrosome.. | |
Protein Sequence | MASSSGAGAAAAAAAANLNAVRETMDVLLEISRILNTGLDMETLSICVRLCEQGINPEALSSVIKELRKATEALKAAENMTS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MASSSGAGA ------CCCCCHHHH | 20.37 | 22814378 | |
3 | Phosphorylation | -----MASSSGAGAA -----CCCCCHHHHH | 24.60 | 21955146 | |
4 | Phosphorylation | ----MASSSGAGAAA ----CCCCCHHHHHH | 24.21 | 21955146 | |
5 | Phosphorylation | ---MASSSGAGAAAA ---CCCCCHHHHHHH | 30.11 | 21955146 | |
65 | Ubiquitination | EALSSVIKELRKATE HHHHHHHHHHHHHHH | 48.84 | 21963094 | |
69 | Ubiquitination | SVIKELRKATEALKA HHHHHHHHHHHHHHH | 72.75 | 29967540 | |
71 | Phosphorylation | IKELRKATEALKAAE HHHHHHHHHHHHHHH | 25.48 | - | |
75 | Ubiquitination | RKATEALKAAENMTS HHHHHHHHHHHHCCC | 53.23 | 21963094 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MZT1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MZT1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MZT1_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...