| UniProt ID | MZT2B_HUMAN | |
|---|---|---|
| UniProt AC | Q6NZ67 | |
| Protein Name | Mitotic-spindle organizing protein 2B | |
| Gene Name | MZT2B | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 158 | |
| Subcellular Localization | Cytoplasm, cytoskeleton, microtubule organizing center, centrosome . Cytoplasm, cytoskeleton, spindle . | |
| Protein Description | ||
| Protein Sequence | MAAQGVGPGPGSAAPPGLEAARQKLALRRKKVLSTEEMELYELAQAAGGAIDPDVFKILVDLLKLNVAPLAVFQMLKSMCAGQRLASEPQDPAAVSLPTSSVPETRGRNKGSAALGGALALAERSSREGSSQRMPRQPSATRLPKGGGPGKSPTRGST | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 12 | Phosphorylation | GVGPGPGSAAPPGLE CCCCCCCCCCCCCHH | 25.13 | 28122231 | |
| 24 | Ubiquitination | GLEAARQKLALRRKK CHHHHHHHHHHHHHC | 30.12 | - | |
| 31 | Ubiquitination | KLALRRKKVLSTEEM HHHHHHHCCCCHHHH | 46.74 | - | |
| 34 | Phosphorylation | LRRKKVLSTEEMELY HHHHCCCCHHHHHHH | 36.44 | 30278072 | |
| 35 | Phosphorylation | RRKKVLSTEEMELYE HHHCCCCHHHHHHHH | 31.63 | 28464451 | |
| 41 | Phosphorylation | STEEMELYELAQAAG CHHHHHHHHHHHHCC | 8.80 | 22199227 | |
| 87 | Phosphorylation | CAGQRLASEPQDPAA HHHCHHHCCCCCCCC | 55.17 | 28555341 | |
| 96 | Phosphorylation | PQDPAAVSLPTSSVP CCCCCCCCCCCCCCC | 24.73 | 20071362 | |
| 99 | Phosphorylation | PAAVSLPTSSVPETR CCCCCCCCCCCCCCC | 38.64 | 20071362 | |
| 100 | Phosphorylation | AAVSLPTSSVPETRG CCCCCCCCCCCCCCC | 27.65 | 27251275 | |
| 101 | Phosphorylation | AVSLPTSSVPETRGR CCCCCCCCCCCCCCC | 44.14 | 20071362 | |
| 105 | Phosphorylation | PTSSVPETRGRNKGS CCCCCCCCCCCCHHH | 32.14 | 20071362 | |
| 110 | Ubiquitination | PETRGRNKGSAALGG CCCCCCCHHHHHHHH | 53.53 | - | |
| 112 | Phosphorylation | TRGRNKGSAALGGAL CCCCCHHHHHHHHHH | 16.39 | 29214152 | |
| 125 | Phosphorylation | ALALAERSSREGSSQ HHHHHHHHCCCCCCC | 25.83 | 24719451 | |
| 126 | Phosphorylation | LALAERSSREGSSQR HHHHHHHCCCCCCCC | 40.34 | 23312004 | |
| 130 | Phosphorylation | ERSSREGSSQRMPRQ HHHCCCCCCCCCCCC | 20.67 | 26074081 | |
| 131 | Phosphorylation | RSSREGSSQRMPRQP HHCCCCCCCCCCCCC | 32.44 | 26074081 | |
| 133 | Methylation | SREGSSQRMPRQPSA CCCCCCCCCCCCCCC | 38.73 | 24388001 | |
| 136 | Methylation | GSSQRMPRQPSATRL CCCCCCCCCCCCCCC | 52.26 | 24388009 | |
| 139 | Phosphorylation | QRMPRQPSATRLPKG CCCCCCCCCCCCCCC | 33.65 | 30266825 | |
| 141 | Phosphorylation | MPRQPSATRLPKGGG CCCCCCCCCCCCCCC | 36.76 | 30266825 | |
| 152 | Phosphorylation | KGGGPGKSPTRGST- CCCCCCCCCCCCCC- | 37.10 | 23927012 | |
| 154 | Phosphorylation | GGPGKSPTRGST--- CCCCCCCCCCCC--- | 55.54 | 23927012 | |
| 157 | Phosphorylation | GKSPTRGST------ CCCCCCCCC------ | 27.87 | 30576142 | |
| 158 | Phosphorylation | KSPTRGST------- CCCCCCCC------- | 45.51 | 20363803 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MZT2B_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MZT2B_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MZT2B_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| GCP2_HUMAN | TUBGCP2 | physical | 26186194 | |
| TBG1_HUMAN | TUBG1 | physical | 26186194 | |
| GCP5_HUMAN | TUBGCP5 | physical | 26186194 | |
| GCP3_HUMAN | TUBGCP3 | physical | 26186194 | |
| GCP6_HUMAN | TUBGCP6 | physical | 26186194 | |
| GCP4_HUMAN | TUBGCP4 | physical | 26186194 | |
| NDK7_HUMAN | NME7 | physical | 26186194 | |
| GCP5_HUMAN | TUBGCP5 | physical | 28514442 | |
| GCP6_HUMAN | TUBGCP6 | physical | 28514442 | |
| GCP4_HUMAN | TUBGCP4 | physical | 28514442 | |
| GCP2_HUMAN | TUBGCP2 | physical | 28514442 | |
| GCP3_HUMAN | TUBGCP3 | physical | 28514442 | |
| NDK7_HUMAN | NME7 | physical | 28514442 | |
| LG3BP_HUMAN | LGALS3BP | physical | 28514442 | |
| TBG1_HUMAN | TUBG1 | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...