UniProt ID | MZT2B_HUMAN | |
---|---|---|
UniProt AC | Q6NZ67 | |
Protein Name | Mitotic-spindle organizing protein 2B | |
Gene Name | MZT2B | |
Organism | Homo sapiens (Human). | |
Sequence Length | 158 | |
Subcellular Localization | Cytoplasm, cytoskeleton, microtubule organizing center, centrosome . Cytoplasm, cytoskeleton, spindle . | |
Protein Description | ||
Protein Sequence | MAAQGVGPGPGSAAPPGLEAARQKLALRRKKVLSTEEMELYELAQAAGGAIDPDVFKILVDLLKLNVAPLAVFQMLKSMCAGQRLASEPQDPAAVSLPTSSVPETRGRNKGSAALGGALALAERSSREGSSQRMPRQPSATRLPKGGGPGKSPTRGST | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
12 | Phosphorylation | GVGPGPGSAAPPGLE CCCCCCCCCCCCCHH | 25.13 | 28122231 | |
24 | Ubiquitination | GLEAARQKLALRRKK CHHHHHHHHHHHHHC | 30.12 | - | |
31 | Ubiquitination | KLALRRKKVLSTEEM HHHHHHHCCCCHHHH | 46.74 | - | |
34 | Phosphorylation | LRRKKVLSTEEMELY HHHHCCCCHHHHHHH | 36.44 | 30278072 | |
35 | Phosphorylation | RRKKVLSTEEMELYE HHHCCCCHHHHHHHH | 31.63 | 28464451 | |
41 | Phosphorylation | STEEMELYELAQAAG CHHHHHHHHHHHHCC | 8.80 | 22199227 | |
87 | Phosphorylation | CAGQRLASEPQDPAA HHHCHHHCCCCCCCC | 55.17 | 28555341 | |
96 | Phosphorylation | PQDPAAVSLPTSSVP CCCCCCCCCCCCCCC | 24.73 | 20071362 | |
99 | Phosphorylation | PAAVSLPTSSVPETR CCCCCCCCCCCCCCC | 38.64 | 20071362 | |
100 | Phosphorylation | AAVSLPTSSVPETRG CCCCCCCCCCCCCCC | 27.65 | 27251275 | |
101 | Phosphorylation | AVSLPTSSVPETRGR CCCCCCCCCCCCCCC | 44.14 | 20071362 | |
105 | Phosphorylation | PTSSVPETRGRNKGS CCCCCCCCCCCCHHH | 32.14 | 20071362 | |
110 | Ubiquitination | PETRGRNKGSAALGG CCCCCCCHHHHHHHH | 53.53 | - | |
112 | Phosphorylation | TRGRNKGSAALGGAL CCCCCHHHHHHHHHH | 16.39 | 29214152 | |
125 | Phosphorylation | ALALAERSSREGSSQ HHHHHHHHCCCCCCC | 25.83 | 24719451 | |
126 | Phosphorylation | LALAERSSREGSSQR HHHHHHHCCCCCCCC | 40.34 | 23312004 | |
130 | Phosphorylation | ERSSREGSSQRMPRQ HHHCCCCCCCCCCCC | 20.67 | 26074081 | |
131 | Phosphorylation | RSSREGSSQRMPRQP HHCCCCCCCCCCCCC | 32.44 | 26074081 | |
133 | Methylation | SREGSSQRMPRQPSA CCCCCCCCCCCCCCC | 38.73 | 24388001 | |
136 | Methylation | GSSQRMPRQPSATRL CCCCCCCCCCCCCCC | 52.26 | 24388009 | |
139 | Phosphorylation | QRMPRQPSATRLPKG CCCCCCCCCCCCCCC | 33.65 | 30266825 | |
141 | Phosphorylation | MPRQPSATRLPKGGG CCCCCCCCCCCCCCC | 36.76 | 30266825 | |
152 | Phosphorylation | KGGGPGKSPTRGST- CCCCCCCCCCCCCC- | 37.10 | 23927012 | |
154 | Phosphorylation | GGPGKSPTRGST--- CCCCCCCCCCCC--- | 55.54 | 23927012 | |
157 | Phosphorylation | GKSPTRGST------ CCCCCCCCC------ | 27.87 | 30576142 | |
158 | Phosphorylation | KSPTRGST------- CCCCCCCC------- | 45.51 | 20363803 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MZT2B_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MZT2B_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MZT2B_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
GCP2_HUMAN | TUBGCP2 | physical | 26186194 | |
TBG1_HUMAN | TUBG1 | physical | 26186194 | |
GCP5_HUMAN | TUBGCP5 | physical | 26186194 | |
GCP3_HUMAN | TUBGCP3 | physical | 26186194 | |
GCP6_HUMAN | TUBGCP6 | physical | 26186194 | |
GCP4_HUMAN | TUBGCP4 | physical | 26186194 | |
NDK7_HUMAN | NME7 | physical | 26186194 | |
GCP5_HUMAN | TUBGCP5 | physical | 28514442 | |
GCP6_HUMAN | TUBGCP6 | physical | 28514442 | |
GCP4_HUMAN | TUBGCP4 | physical | 28514442 | |
GCP2_HUMAN | TUBGCP2 | physical | 28514442 | |
GCP3_HUMAN | TUBGCP3 | physical | 28514442 | |
NDK7_HUMAN | NME7 | physical | 28514442 | |
LG3BP_HUMAN | LGALS3BP | physical | 28514442 | |
TBG1_HUMAN | TUBG1 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...