UniProt ID | MZT2A_HUMAN | |
---|---|---|
UniProt AC | Q6P582 | |
Protein Name | Mitotic-spindle organizing protein 2A | |
Gene Name | MZT2A | |
Organism | Homo sapiens (Human). | |
Sequence Length | 158 | |
Subcellular Localization | Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton, spindle. | |
Protein Description | ||
Protein Sequence | MAAQGVGPGPGSAAPPGLEAARQKLALRRKKVLSTEEMELYELAQAAGGGIDPDVFKILVDLLKLNVAPLAVFQMLKSMCAGQRLASEPQDPAAVSLPTSSVPETRGRDKGSAALGGVLALAERSNHEGSSQRMPRQPSATRLPKGGGPGKSPTQGST | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MAAQGVGPG ------CCCCCCCCC | 14.43 | - | |
12 | Phosphorylation | GVGPGPGSAAPPGLE CCCCCCCCCCCCCHH | 25.13 | 28122231 | |
24 | Ubiquitination | GLEAARQKLALRRKK CHHHHHHHHHHHHHC | 30.12 | - | |
31 | Ubiquitination | KLALRRKKVLSTEEM HHHHHHHCCCCHHHH | 46.74 | 29967540 | |
34 | Phosphorylation | LRRKKVLSTEEMELY HHHHCCCCHHHHHHH | 36.44 | 20068231 | |
35 | Phosphorylation | RRKKVLSTEEMELYE HHHCCCCHHHHHHHH | 31.63 | 27251275 | |
41 | Phosphorylation | STEEMELYELAQAAG CHHHHHHHHHHHHCC | 8.80 | 27251275 | |
77 | Ubiquitination | LAVFQMLKSMCAGQR HHHHHHHHHHHHHCH | 30.70 | 32015554 | |
87 | Phosphorylation | CAGQRLASEPQDPAA HHHCHHHCCCCCCCC | 55.17 | 28555341 | |
96 | Phosphorylation | PQDPAAVSLPTSSVP CCCCCCCCCCCCCCC | 24.73 | 20071362 | |
99 | Phosphorylation | PAAVSLPTSSVPETR CCCCCCCCCCCCCCC | 38.64 | 20071362 | |
100 | Phosphorylation | AAVSLPTSSVPETRG CCCCCCCCCCCCCCC | 27.65 | 20071362 | |
101 | Phosphorylation | AVSLPTSSVPETRGR CCCCCCCCCCCCCCC | 44.14 | 20071362 | |
105 | Phosphorylation | PTSSVPETRGRDKGS CCCCCCCCCCCCHHH | 32.14 | 20071362 | |
110 | Ubiquitination | PETRGRDKGSAALGG CCCCCCCHHHHHHHH | 54.10 | - | |
112 | Phosphorylation | TRGRDKGSAALGGVL CCCCCHHHHHHHHHH | 18.99 | 30001349 | |
130 | Phosphorylation | ERSNHEGSSQRMPRQ HHCCCCCCCCCCCCC | 21.95 | 26074081 | |
131 | Phosphorylation | RSNHEGSSQRMPRQP HCCCCCCCCCCCCCC | 32.44 | 26074081 | |
133 | Methylation | NHEGSSQRMPRQPSA CCCCCCCCCCCCCCC | 38.73 | 24388017 | |
136 | Methylation | GSSQRMPRQPSATRL CCCCCCCCCCCCCCC | 52.26 | 24388023 | |
139 | Phosphorylation | QRMPRQPSATRLPKG CCCCCCCCCCCCCCC | 33.65 | 30266825 | |
141 | Phosphorylation | MPRQPSATRLPKGGG CCCCCCCCCCCCCCC | 36.76 | 30266825 | |
145 | Ubiquitination | PSATRLPKGGGPGKS CCCCCCCCCCCCCCC | 74.83 | 24816145 | |
152 | Phosphorylation | KGGGPGKSPTQGST- CCCCCCCCCCCCCC- | 38.81 | 21955146 | |
154 | Phosphorylation | GGPGKSPTQGST--- CCCCCCCCCCCC--- | 53.29 | 27794612 | |
157 | Phosphorylation | GKSPTQGST------ CCCCCCCCC------ | 22.56 | 22199227 | |
158 | Phosphorylation | KSPTQGST------- CCCCCCCC------- | 49.83 | 22199227 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MZT2A_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MZT2A_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MZT2A_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY. |