UniProt ID | CDX1_HUMAN | |
---|---|---|
UniProt AC | P47902 | |
Protein Name | Homeobox protein CDX-1 | |
Gene Name | CDX1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 265 | |
Subcellular Localization | Nucleus. | |
Protein Description | Plays a role in transcriptional regulation. [PubMed: 24623306 Involved in activated KRAS-mediated transcriptional activation of PRKD1 in colorectal cancer (CRC) cells] | |
Protein Sequence | MYVGYVLDKDSPVYPGPARPASLGLGPQAYGPPAPPPAPPQYPDFSSYSHVEPAPAPPTAWGAPFPAPKDDWAAAYGPGPAAPAASPASLAFGPPPDFSPVPAPPGPGPGLLAQPLGGPGTPSSPGAQRPTPYEWMRRSVAAGGGGGSGKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKSELAANLGLTERQVKIWFQNRRAKERKVNKKKQQQQQPPQPPMAHDITATPAGPSLGGLCPSNTSLLATSSPMPVKEEFLP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MYVGYVLDK ------CCEEEEECC | 11.55 | - | |
5 | Phosphorylation | ---MYVGYVLDKDSP ---CCEEEEECCCCC | 6.44 | - | |
11 | Phosphorylation | GYVLDKDSPVYPGPA EEEECCCCCCCCCCC | 23.23 | 23312004 | |
14 | Phosphorylation | LDKDSPVYPGPARPA ECCCCCCCCCCCCCH | 13.07 | - | |
139 | O-linked_Glycosylation | PYEWMRRSVAAGGGG CHHHHHHHHHCCCCC | 13.02 | 30379171 | |
148 | Phosphorylation | AAGGGGGSGKTRTKD HCCCCCCCCCCCCCC | 40.15 | - | |
148 | O-linked_Glycosylation | AAGGGGGSGKTRTKD HCCCCCCCCCCCCCC | 40.15 | 30379171 | |
185 | Phosphorylation | YITIRRKSELAANLG EEEEEHHHHHHHHCC | 35.71 | 23312004 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CDX1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CDX1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CDX1_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...