dbPTM

YJL8_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YJL8_YEAST
UniProt AC	P47022
Protein Name	Uncharacterized protein YJL118W
Gene Name	YJL118W
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	219
Subcellular Localization	Membrane Multi-pass membrane protein .
Protein Description
Protein Sequence	MASCFSVSLLARVAVVEPIRVQLWLNVVNCMIESSMHQCPPRDRHFFSSSRPILLIRRSVSTVYRFVASRTTQVLRAAKTVVKWFIIVDPLINSILINYLIDRLCTLGHAVLRVKKRKTEERQPCSPIIQHTHVKRRKRPRLRIVAIKRKRRRRRPHRIERPLSNMYPIMEIQMVAVPLALPSPTALVHYQQQQQQLPQHHPWYDLSLSEEALSTCCCS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
126	Phosphorylation	TEERQPCSPIIQHTH CCCCCCCCCCCCCHH	26.30	27017623

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YJL8_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YJL8_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YJL8_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
YIP5_YEAST	YIP5	genetic	27708008
VAM10_YEAST	VAM10	genetic	27708008
MED8_YEAST	MED8	genetic	27708008
SEC65_YEAST	SEC65	genetic	27708008
OST2_YEAST	OST2	genetic	27708008
MED4_YEAST	MED4	genetic	27708008
BUR1_YEAST	SGV1	genetic	27708008
MIG1_YEAST	MIG1	genetic	27708008
YBP2_YEAST	YBP2	genetic	27708008
GCN1_YEAST	GCN1	genetic	27708008
ACOX_YEAST	POX1	genetic	27708008
MNT2_YEAST	MNT2	genetic	27708008
RT13_YEAST	MRP13	genetic	27708008
RSR1_YEAST	RSR1	genetic	27708008
PBP1_YEAST	PBP1	genetic	27708008
SLI1_YEAST	SLI1	genetic	27708008
NAM8_YEAST	NAM8	genetic	27708008
VPS24_YEAST	VPS24	genetic	27708008
YRA2_YEAST	YRA2	genetic	27708008
FRA1_YEAST	FRA1	genetic	27708008
MET22_YEAST	MET22	genetic	27708008
VAM3_YEAST	VAM3	genetic	27708008
YP022_YEAST	YPR022C	genetic	27708008
PDC2_YEAST	PDC2	genetic	29674565
RKM2_YEAST	RKM2	genetic	29674565
SKT5_YEAST	SKT5	genetic	29674565
EF1A_YEAST	TEF2	genetic	29674565
RV161_YEAST	RVS161	genetic	29674565
APC11_YEAST	APC11	genetic	29674565
TFB1_YEAST	TFB1	genetic	29674565
CDC26_YEAST	CDC26	genetic	29674565
AXL2_YEAST	AXL2	genetic	29674565
ELM1_YEAST	ELM1	genetic	29674565
VPS51_YEAST	VPS51	genetic	29674565
BET3_YEAST	BET3	genetic	29674565
CDC73_YEAST	CDC73	genetic	29674565
MPIP_YEAST	MIH1	genetic	29674565
NUF2_YEAST	NUF2	genetic	29674565
DGK1_YEAST	DGK1	genetic	29674565
NIP80_YEAST	NIP100	genetic	29674565

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YJL8_YEAST

Related Literatures of Post-Translational Modification