dbPTM

YB029_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YB029_YEAST
UniProt AC	Q3E756
Protein Name	UPF0768 protein YBL029C-A
Gene Name	YBL029C-A
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	94
Subcellular Localization	Cell membrane Peripheral membrane protein . Cell periphery.
Protein Description
Protein Sequence	MSFIPIVCGMKSFDSSYDTVPGHQNLYCPNCHNYSVGPIKRKEFFTIWFIPLVPVFWGKQLHCPICNWRQDFKNDEQLNKVIQEQQNLRQKQPN

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
80	Ubiquitination	KNDEQLNKVIQEQQN CCHHHHHHHHHHHHH	49.67	23749301

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YB029_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YB029_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YB029_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
FMP45_YEAST	FMP45	physical	18467557
FTR1_YEAST	FTR1	physical	18467557
TPO1_YEAST	TPO1	physical	18467557
SFK1_YEAST	SFK1	physical	18467557
GPA2_YEAST	GPA2	physical	18467557
GPX3_YEAST	HYR1	physical	18467557
PST2_YEAST	PST2	physical	18467557
QDR2_YEAST	QDR2	physical	18467557
ARF1_YEAST	ARF1	physical	18467557
HXT5_YEAST	HXT5	physical	18467557
MUP1_YEAST	MUP1	physical	18467557
SDS23_YEAST	SDS23	physical	18467557
TCB3_YEAST	TCB3	physical	18467557
HSP30_YEAST	HSP30	physical	18467557
FMP45_YEAST	FMP45	physical	22615397
YCY0_YEAST	YCR090C	genetic	27708008
GPR1_YEAST	GPR1	genetic	27708008
MRM2_YEAST	MRM2	genetic	27708008
CSN12_YEAST	YJR084W	genetic	27708008
INO4_YEAST	INO4	genetic	27708008
PRP9_YEAST	PRP9	genetic	27708008
TSC11_YEAST	TSC11	genetic	27708008
DAM1_YEAST	DAM1	genetic	27708008
RHO3_YEAST	RHO3	genetic	27708008
ARP4_YEAST	ARP4	genetic	27708008
KTHY_YEAST	CDC8	genetic	27708008
CDC11_YEAST	CDC11	genetic	27708008
SED5_YEAST	SED5	genetic	27708008
ORC1_YEAST	ORC1	genetic	27708008
MCM1_YEAST	MCM1	genetic	27708008
DIB1_YEAST	DIB1	genetic	27708008
SNF6_YEAST	SNF6	genetic	27708008
TGS1_YEAST	TGS1	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YB029_YEAST

Related Literatures of Post-Translational Modification