dbPTM

SDHF1_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SDHF1_YEAST
UniProt AC	Q3E785
Protein Name	Succinate dehydrogenase assembly factor 1, mitochondrial {ECO:0000303\|PubMed:19465911}
Gene Name	SDH6 {ECO:0000303\|PubMed:24954417}
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	79
Subcellular Localization	Mitochondrion matrix .
Protein Description	Plays an essential role in the assembly of succinate dehydrogenase (SDH), an enzyme complex (also referred to as respiratory complex II) that is a component of both the tricarboxylic acid (TCA) cycle and the mitochondrial electron transport chain, and which couples the oxidation of succinate to fumarate with the reduction of ubiquinone (coenzyme Q) to ubiquinol. Promotes maturation of the iron-sulfur protein subunit SDH2 of the SDH catalytic dimer, protecting it from the deleterious effects of oxidants. Acts together with SDHAF3 (SDH7)..
Protein Sequence	MPKRLSGLQKEVLHLYRASIRTAHTKPKENQVNFVNYIHEEFGKYRNLPRKDFTTIEHLLRVGNKKIATFSHPELTNIH

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of SDHF1_YEAST !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SDHF1_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SDHF1_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SDHF1_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SDHF3_YEAST	SDH7	genetic	24954417
SDHA_YEAST	SDH1	physical	24954417
SDHB_YEAST	SDH2	physical	24954417
AP1_YEAST	YAP1	genetic	24954417
BET3_YEAST	BET3	genetic	27708008
YG1X_YEAST	YGR050C	genetic	27708008
CALM_YEAST	CMD1	genetic	27708008
SLU7_YEAST	SLU7	genetic	27708008
ACT_YEAST	ACT1	genetic	27708008
MCE1_YEAST	CEG1	genetic	27708008
SYMC_YEAST	MES1	genetic	27708008
HSP77_YEAST	SSC1	genetic	27708008
RNA1_YEAST	RNA1	genetic	27708008
EI2BG_YEAST	GCD1	genetic	27708008
SYA_YEAST	ALA1	genetic	27708008
GPI2_YEAST	GPI2	genetic	27708008
DIB1_YEAST	DIB1	genetic	27708008
ICS2_YEAST	ICS2	genetic	27708008
SWC5_YEAST	SWC5	genetic	27708008
NHP10_YEAST	NHP10	genetic	27708008
VPS41_YEAST	VPS41	genetic	27708008
RM01_YEAST	MRPL1	genetic	27708008
VAM7_YEAST	VAM7	genetic	27708008
MAL12_YEAST	MAL12	genetic	27708008
YJY1_YEAST	YJR011C	genetic	27708008
SAC1_YEAST	SAC1	genetic	27708008
POM33_YEAST	POM33	genetic	27708008
PUR91_YEAST	ADE16	genetic	27708008
PET8_YEAST	PET8	genetic	27708008
MSC6_YEAST	MSC6	genetic	27708008
RAD1_YEAST	RAD1	genetic	27708008
RU2A_YEAST	LEA1	genetic	27708008
YBF9_YEAST	YBL059W	genetic	29674565
CSG2_YEAST	CSG2	genetic	29674565
INO2_YEAST	INO2	genetic	29674565
SAC3_YEAST	SAC3	genetic	29674565
SDHB_YEAST	SDH2	genetic	29674565
RIC1_YEAST	RIC1	genetic	29674565
SCS7_YEAST	SCS7	genetic	29674565
RTC6_YEAST	RTC6	genetic	29674565
FUMH_YEAST	FUM1	genetic	29674565
MAK5_YEAST	MAK5	genetic	29674565

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SDHF1_YEAST

Related Literatures of Post-Translational Modification