UniProt ID | RRF1_YEAST | |
---|---|---|
UniProt AC | P38771 | |
Protein Name | Ribosome-recycling factor, mitochondrial | |
Gene Name | RRF1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 230 | |
Subcellular Localization | Mitochondrion . | |
Protein Description | Necessary for protein synthesis in mitochondria. Function as a ribosome recycling factor in mitochondria.. | |
Protein Sequence | MILTTARLNCRPVTVPRLFNRSFSQSFIILKKKSSTPTEKVEEDEIDVNELLKKAETQFKKTLEIQKQKMNEIKQGNFNPKVFNSLVFKNNRKFTDIATTSLKGKNALLITVFDPKDVKTVISGVLAANLNLTPERVPNNDLQLKVSLPPPTTESRLKVAKDLKRVFEEYKQSSLKDSLGTIRGSILKEFKSFKKDDAVRKAERDLEKLHKDYVNKLHDQFQKVEKSIVK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
22 | Phosphorylation | VPRLFNRSFSQSFII HHHHCCCCCCEEEEE | 30.29 | 22890988 | |
24 | Phosphorylation | RLFNRSFSQSFIILK HHCCCCCCEEEEEEE | 26.59 | 21440633 | |
26 | Phosphorylation | FNRSFSQSFIILKKK CCCCCCEEEEEEEEC | 19.74 | 22890988 | |
38 | Phosphorylation | KKKSSTPTEKVEEDE EECCCCCCCHHCHHC | 48.83 | 28889911 | |
81 | Acetylation | KQGNFNPKVFNSLVF HCCCCCHHHHHHEEE | 61.64 | 24489116 | |
116 | Acetylation | LITVFDPKDVKTVIS EEEECCHHHHHHHHH | 76.60 | 24489116 | |
171 | Acetylation | KRVFEEYKQSSLKDS HHHHHHHHHHHHHHH | 47.16 | 24489116 | |
216 | Acetylation | LHKDYVNKLHDQFQK HHHHHHHHHHHHHHH | 36.84 | 24489116 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RRF1_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RRF1_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RRF1_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...