UniProt ID | CMTD1_HUMAN | |
---|---|---|
UniProt AC | Q86VU5 | |
Protein Name | Catechol O-methyltransferase domain-containing protein 1 | |
Gene Name | COMTD1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 262 | |
Subcellular Localization |
Membrane Single-pass type II membrane protein . |
|
Protein Description | Putative O-methyltransferase.. | |
Protein Sequence | MTQPVPRLSVPAALALGSAALGAAFATGLFLGRRCPPWRGRREQCLLPPEDSRLWQYLLSRSMREHPALRSLRLLTLEQPQGDSMMTCEQAQLLANLARLIQAKKALDLGTFTGYSALALALALPADGRVVTCEVDAQPPELGRPLWRQAEAEHKIDLRLKPALETLDELLAAGEAGTFDVAVVDADKENCSAYYERCLQLLRPGGILAVLRVLWRGKVLQPPKGDVAAECVRNLNERIRRDVRVYISLLPLGDGLTLAFKI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
18 | Phosphorylation | PAALALGSAALGAAF HHHHHHHHHHHHHHH | 15.95 | 24719451 | |
27 | Phosphorylation | ALGAAFATGLFLGRR HHHHHHHHCHHHCCC | 28.15 | 24719451 | |
35 | S-palmitoylation | GLFLGRRCPPWRGRR CHHHCCCCCCCCCCC | 4.59 | 29575903 | |
71 | Phosphorylation | REHPALRSLRLLTLE HHCHHHHHHEEEEEC | 20.77 | 26670566 | |
161 | Ubiquitination | HKIDLRLKPALETLD HHCCCCCHHHHHHHH | 23.08 | 29967540 | |
224 | Ubiquitination | GKVLQPPKGDVAAEC CCCCCCCCCCHHHHH | 74.54 | 33845483 | |
246 | Phosphorylation | IRRDVRVYISLLPLG HHHHHHHEEEEEECC | 3.68 | 29083192 | |
248 | Phosphorylation | RDVRVYISLLPLGDG HHHHHEEEEEECCCC | 13.23 | 29083192 | |
257 | Phosphorylation | LPLGDGLTLAFKI-- EECCCCEEEEEEC-- | 22.90 | 29083192 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CMTD1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CMTD1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CMTD1_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...