| UniProt ID | ASH2L_HUMAN | |
|---|---|---|
| UniProt AC | Q9UBL3 | |
| Protein Name | Set1/Ash2 histone methyltransferase complex subunit ASH2 | |
| Gene Name | ASH2L | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 628 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Component of the Set1/Ash2 histone methyltransferase (HMT) complex, a complex that specifically methylates 'Lys-4' of histone H3, but not if the neighboring 'Lys-9' residue is already methylated. As part of the MLL1/MLL complex it is involved in methylation and dimethylation at 'Lys-4' of histone H3. May function as a transcriptional regulator. May play a role in hematopoiesis.. | |
| Protein Sequence | MAAAGAGPGQEAGAGPGPGAVANATGAEEGEMKPVAAGAAAPPGEGISAAPTVEPSSGEAEGGEANLVDVSGGLETESSNGKDTLEGAGDTSEVMDTQAGSVDEENGRQLGEVELQCGICTKWFTADTFGIDTSSCLPFMTNYSFHCNVCHHSGNTYFLRKQANLKEMCLSALANLTWQSRTQDEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKMTWPNNIVKTMSKERDVFLVKEHPDPGSKDPEEDYPKFGLLDQDLSNIGPAYDNQKQSSAVSTSGNLNGGIAAGSSGKGRGAKRKQQDGGTTGTTKKARSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLELDCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGYGQGDVLGFYINLPEDTETAKSLPDTYKDKALIKFKSYLYFEEKDFVDKAEKSLKQTPHSEIIFYKNGVNQGVAYKDIFEGVYFPAISLYKSCTVSINFGPCFKYPPKDLTYRPMSDMGWGAVVEHTLADVLYHVETEVDGRRSPPWEP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 (in isoform 3) | Acetylation | - | 5.30 | 22814378 | |
| 1 (in isoform 2) | Acetylation | - | 5.30 | 22814378 | |
| 84 | Phosphorylation | ESSNGKDTLEGAGDT ECCCCCCEECCCCCH | 30.14 | 21406692 | |
| 91 | Phosphorylation | TLEGAGDTSEVMDTQ EECCCCCHHHHHCCC | 26.35 | 29255136 | |
| 92 | Phosphorylation | LEGAGDTSEVMDTQA ECCCCCHHHHHCCCC | 32.69 | 29255136 | |
| 97 | Phosphorylation | DTSEVMDTQAGSVDE CHHHHHCCCCCCCCC | 11.39 | 29255136 | |
| 101 | Phosphorylation | VMDTQAGSVDEENGR HHCCCCCCCCCCCCE | 29.43 | 29255136 | |
| 193 | Ubiquitination | HPKTMFSKDKDIIPF CCCCCCCCCCCCHHH | 58.49 | - | |
| 195 | 2-Hydroxyisobutyrylation | KTMFSKDKDIIPFID CCCCCCCCCCHHHHH | 55.34 | - | |
| 195 | Ubiquitination | KTMFSKDKDIIPFID CCCCCCCCCCHHHHH | 55.34 | - | |
| 203 | Acetylation | DIIPFIDKYWECMTT CCHHHHHHHHHHCCC | 47.66 | 26051181 | |
| 204 | Phosphorylation | IIPFIDKYWECMTTR CHHHHHHHHHHCCCC | 11.59 | 22817900 | |
| 216 | Acetylation | TTRQRPGKMTWPNNI CCCCCCCCCCCCCCH | 35.52 | 25953088 | |
| 225 | Acetylation | TWPNNIVKTMSKERD CCCCCHHHHCCCCCC | 34.41 | 25953088 | |
| 244 (in isoform 3) | Ubiquitination | - | 38.99 | 21890473 | |
| 244 | Ubiquitination | KEHPDPGSKDPEEDY EECCCCCCCCHHHHC | 38.99 | 21890473 | |
| 244 (in isoform 2) | Ubiquitination | - | 38.99 | 21890473 | |
| 245 | Acetylation | EHPDPGSKDPEEDYP ECCCCCCCCHHHHCC | 81.08 | 23236377 | |
| 253 | Ubiquitination | DPEEDYPKFGLLDQD CHHHHCCCCCCCCHH | 45.92 | - | |
| 262 | Phosphorylation | GLLDQDLSNIGPAYD CCCCHHHHHCCCCCC | 34.39 | 30377224 | |
| 278 | Phosphorylation | QKQSSAVSTSGNLNG CCCCCCCCCCCCCCC | 19.30 | 28857561 | |
| 279 | Phosphorylation | KQSSAVSTSGNLNGG CCCCCCCCCCCCCCC | 33.77 | 28857561 | |
| 280 | Phosphorylation | QSSAVSTSGNLNGGI CCCCCCCCCCCCCCC | 20.41 | 28857561 | |
| 291 | Phosphorylation | NGGIAAGSSGKGRGA CCCCCCCCCCCCCCC | 31.06 | 21815630 | |
| 292 | Phosphorylation | GGIAAGSSGKGRGAK CCCCCCCCCCCCCCC | 43.54 | 21815630 | |
| 294 | Acetylation | IAAGSSGKGRGAKRK CCCCCCCCCCCCCCC | 47.59 | 26051181 | |
| 296 | Asymmetric dimethylarginine | AGSSGKGRGAKRKQQ CCCCCCCCCCCCCCC | 45.44 | - | |
| 296 | Methylation | AGSSGKGRGAKRKQQ CCCCCCCCCCCCCCC | 45.44 | 21285357 | |
| 301 | Methylation | KGRGAKRKQQDGGTT CCCCCCCCCCCCCCC | 52.16 | - | |
| 312 | Ubiquitination | GGTTGTTKKARSDPL CCCCCCCCCCCCCCC | 44.25 | - | |
| 316 | Phosphorylation | GTTKKARSDPLFSAQ CCCCCCCCCCCCCCC | 48.73 | 25159151 | |
| 321 | Phosphorylation | ARSDPLFSAQRLPPH CCCCCCCCCCCCCCC | 31.04 | 21815630 | |
| 338 | Ubiquitination | PLEHPFNKDGYRYIL CCCCCCCCCCCEEEE | 53.56 | 21890473 | |
| 338 (in isoform 1) | Ubiquitination | - | 53.56 | 21890473 | |
| 357 | Ubiquitination | PHAPDPEKLELDCWA CCCCCHHHCCCEECC | 53.28 | - | |
| 366 | Ubiquitination | ELDCWAGKPIPGDLY CCEECCCCCCCCHHH | 31.84 | - | |
| 366 | Acetylation | ELDCWAGKPIPGDLY CCEECCCCCCCCHHH | 31.84 | 26051181 | |
| 388 | Methylation | VLLALHDRAPQLKIS HHHHHHCCCCCCEEC | 37.10 | - | |
| 393 | Ubiquitination | HDRAPQLKISDDRLT HCCCCCCEECCCCEE | 34.61 | - | |
| 398 | Methylation | QLKISDDRLTVVGEK CCEECCCCEEEEECC | 36.93 | - | |
| 405 | Ubiquitination | RLTVVGEKGYSMVRA CEEEEECCCHHEHHH | 58.16 | - | |
| 407 | Phosphorylation | TVVGEKGYSMVRASH EEEECCCHHEHHHHC | 12.50 | 22817900 | |
| 440 (in isoform 2) | Ubiquitination | - | 9.82 | - | |
| 458 | Phosphorylation | LGYDKFSYSWRSKKG CCCCCCCCEEECCCC | 18.51 | 23186163 | |
| 459 | Phosphorylation | GYDKFSYSWRSKKGT CCCCCCCEEECCCCC | 18.15 | 23186163 | |
| 467 | Ubiquitination | WRSKKGTKFHQSIGK EECCCCCCCHHHHHC | 49.90 | - | |
| 476 | Phosphorylation | HQSIGKHYSSGYGQG HHHHHCCCCCCCCCC | 14.17 | 30576142 | |
| 478 | Phosphorylation | SIGKHYSSGYGQGDV HHHCCCCCCCCCCCE | 28.94 | 30576142 | |
| 500 | Ubiquitination | PEDTETAKSLPDTYK CCCCHHHHHCCCCCC | 61.00 | - | |
| 501 | Phosphorylation | EDTETAKSLPDTYKD CCCHHHHHCCCCCCC | 42.54 | 27251275 | |
| 505 | Phosphorylation | TAKSLPDTYKDKALI HHHHCCCCCCCHHHH | 30.45 | 30576142 | |
| 507 | Ubiquitination | KSLPDTYKDKALIKF HHCCCCCCCHHHHEE | 55.64 | - | |
| 509 | Ubiquitination | LPDTYKDKALIKFKS CCCCCCCHHHHEEEE | 40.72 | - | |
| 513 | Acetylation | YKDKALIKFKSYLYF CCCHHHHEEEEEEEE | 47.81 | 26051181 | |
| 516 | Phosphorylation | KALIKFKSYLYFEEK HHHHEEEEEEEEECH | 24.41 | 22461510 | |
| 517 | Phosphorylation | ALIKFKSYLYFEEKD HHHEEEEEEEEECHH | 13.15 | 22817900 | |
| 519 | Phosphorylation | IKFKSYLYFEEKDFV HEEEEEEEEECHHHH | 10.74 | 22817900 | |
| 531 | Ubiquitination | DFVDKAEKSLKQTPH HHHHHHHHHHCCCCC | 66.98 | - | |
| 534 | Ubiquitination | DKAEKSLKQTPHSEI HHHHHHHCCCCCCEE | 60.25 | - | |
| 562 | Phosphorylation | KDIFEGVYFPAISLY HHHHCCCCCCHHHEE | 18.07 | 26074081 | |
| 567 | Phosphorylation | GVYFPAISLYKSCTV CCCCCHHHEECCCEE | 27.96 | 26074081 | |
| 569 | Phosphorylation | YFPAISLYKSCTVSI CCCHHHEECCCEEEE | 8.28 | 26074081 | |
| 616 | Phosphorylation | DVLYHVETEVDGRRS HHHHHEEECCCCCCC | 39.97 | 26074081 | |
| 623 | Phosphorylation | TEVDGRRSPPWEP-- ECCCCCCCCCCCC-- | 33.67 | 30266825 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ASH2L_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ASH2L_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ASH2L_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
