TSA2_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TSA2_YEAST
• UniProt AC: Q04120
• Protein Name: Peroxiredoxin TSA2 {ECO:0000305}
• Gene Name: TSA2 {ECO:0000303|PubMed:11741925}
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 196
• Subcellular Localization: Cytoplasm .
• Protein Description: Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. [PubMed: 10681558]
• Protein Sequence: MVAEVQKQAPPFKKTAVVDGIFEEISLEKYKGKYVVLAFVPLAFSFVCPTEIVAFSDAAKKFEDQGAQVLFASTDSEYSLLAWTNLPRKDGGLGPVKVPLLADKNHSLSRDYGVLIEKEGIALRGLFIIDPKGIIRHITINDLSVGRNVNEALRLVEGFQWTDKNGTVLPCNWTPGAATIKPDVKDSKEYFKNANN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
118	Ubiquitination	DYGVLIEKEGIALRG CEEEEEEECCEEEEE	55.00	24961812
118	Acetylation	DYGVLIEKEGIALRG CEEEEEEECCEEEEE	55.00	24489116
132	Acetylation	GLFIIDPKGIIRHIT EEEEECCCCEEEEEE	60.02	24489116
164	Ubiquitination	EGFQWTDKNGTVLPC CCCEEECCCCCEEEC	50.32	22817900
174	Phosphorylation	TVLPCNWTPGAATIK CEEECCCCCCCCEEC	9.61	24909858

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TSA2_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TSA2_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TSA2_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TSA1_YEAST	TSA1	physical	16554755
YJ55_YEAST	YJR085C	physical	18467557
TSA1_YEAST	TSA1	physical	18719252
SLX5_YEAST	SLX5	genetic	20093466
RRP8_YEAST	RRP8	genetic	20093466
UBC13_YEAST	UBC13	genetic	20093466
SLX8_YEAST	SLX8	genetic	20093466
UBP6_YEAST	UBP6	genetic	20093466
RTG2_YEAST	RTG2	genetic	20093466
ACA2_YEAST	CST6	genetic	20093466
MRT4_YEAST	MRT4	genetic	20093466
BAS1_YEAST	BAS1	genetic	20093466
PFKA2_YEAST	PFK2	genetic	20093466
MKS1_YEAST	MKS1	genetic	20093466
VPH1_YEAST	VPH1	genetic	20093466
NEW1_YEAST	NEW1	genetic	20093466
NIP80_YEAST	NIP100	genetic	20093466
NACB1_YEAST	EGD1	genetic	20093466
PRX1_YEAST	PRX1	genetic	21282621
AHP1_YEAST	AHP1	genetic	21282621
GPX2_YEAST	GPX2	genetic	21282621
GPX1_YEAST	GPX1	genetic	21282621
GPX3_YEAST	HYR1	genetic	21282621
HS104_YEAST	HSP104	genetic	21832086
RNQ1_YEAST	RNQ1	genetic	21832086
CATT_YEAST	CTT1	genetic	24418709
FRA1_YEAST	FRA1	physical	23457300
TSA2_YEAST	TSA2	physical	26894543
TRX2_YEAST	TRX2	physical	27816612
SLX5_YEAST	SLX5	genetic	27708008
SLX8_YEAST	SLX8	genetic	27708008
MRM2_YEAST	MRM2	genetic	27708008
RTG2_YEAST	RTG2	genetic	27708008
PHB2_YEAST	PHB2	genetic	27708008
SNF6_YEAST	SNF6	genetic	27708008
ACA2_YEAST	CST6	genetic	27708008
MRT4_YEAST	MRT4	genetic	27708008
IXR1_YEAST	IXR1	genetic	27708008
BAS1_YEAST	BAS1	genetic	27708008
SWI6_YEAST	SWI6	genetic	27708008
PFKA2_YEAST	PFK2	genetic	27708008
MKS1_YEAST	MKS1	genetic	27708008
EOS1_YEAST	EOS1	genetic	27708008
LSM7_YEAST	LSM7	genetic	27708008
VPS68_YEAST	VPS68	genetic	27708008
RRP6_YEAST	RRP6	genetic	27708008
VPH1_YEAST	VPH1	genetic	27708008
NACB1_YEAST	EGD1	genetic	27708008
NEW1_YEAST	NEW1	genetic	27708008
ABP1_YEAST	ABP1	genetic	28369054

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.