| UniProt ID | SKP1_SCHPO | |
|---|---|---|
| UniProt AC | Q9Y709 | |
| Protein Name | Suppressor of kinetochore protein 1 | |
| Gene Name | skp1 {ECO:0000312|EMBL:CAB52607.1} | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 161 | |
| Subcellular Localization | Cytoplasm . Nucleus . | |
| Protein Description | Required for cig2 degradation in the G2 and M phases of the cell cycle. Together with pof6, essential for septum processing and cell separation. Involved in mitotic progression, essential for the execution of anaphase B; required for coordinated structural alterations of mitotic spindles and segregation of nuclear membrane structures at anaphase. Involved in the DNA damage checkpoint pathway and maintenance of genome integrity. Component of the RAVE complex which is required for stable assembly of the vacuolar ATPase complex V-ATPase.. | |
| Protein Sequence | MSKIKLISSDNEEFVVDQLIAERSMLIKNMLEDVGEINVPIPLPNVSSNVLRKVLEWCEHHKNDLYSGTEEESDIRLKKSTDIDEWDRKFMAVDQEMLFEIVLASNYLDIKPLLDTGCKTVANMIRGKSPEDIRKTFNIPNDFTPEEEEQIRKENEWAEDR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 8 | Phosphorylation | MSKIKLISSDNEEFV CCCEEEECCCCCCHH | 41.92 | 25720772 | |
| 9 | Phosphorylation | SKIKLISSDNEEFVV CCEEEECCCCCCHHH | 37.14 | 25720772 | |
| 66 | Phosphorylation | EHHKNDLYSGTEEES HHCCCCCCCCCCCHH | 14.12 | 21712547 | |
| 67 | Phosphorylation | HHKNDLYSGTEEESD HCCCCCCCCCCCHHH | 46.68 | 24763107 | |
| 69 | Phosphorylation | KNDLYSGTEEESDIR CCCCCCCCCCHHHCC | 33.99 | 25720772 | |
| 73 | Phosphorylation | YSGTEEESDIRLKKS CCCCCCHHHCCCCCC | 41.43 | 21712547 | |
| 80 | Phosphorylation | SDIRLKKSTDIDEWD HHCCCCCCCCHHHHH | 29.71 | 24763107 | |
| 129 | Phosphorylation | ANMIRGKSPEDIRKT HHHHCCCCHHHHHHH | 36.02 | 29996109 | |
| 144 | Phosphorylation | FNIPNDFTPEEEEQI CCCCCCCCHHHHHHH | 32.43 | 24763107 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SKP1_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SKP1_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SKP1_SCHPO !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
