UniProt ID | POF14_SCHPO | |
---|---|---|
UniProt AC | Q10223 | |
Protein Name | F-box protein pof14 | |
Gene Name | pof14 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 431 | |
Subcellular Localization | Cytoplasm. Nucleus. Endoplasmic reticulum. Associated with vesicle-like and endoplasmic reticulum (excluding a nuclear rim) structures. | |
Protein Description | Expression is induced during oxidative stress. Plays an essential, SCF-independent, role in the stress response to hydrogen peroxide for survival, by negatively regulating ergosterol synthesis via direct binding to the squalene synthase erg9.. | |
Protein Sequence | MLQFSFQNCKTHTCYMNTSVNEHLDQDESFLRILIDTRKKIRSSYFKPQTFDEFVHCLARVRAMKRLVSICSNFDEEDNWNGVWNTLVVDGDSHASAMIDYEGLLDKCSLSRNLLELINDYAEYTTQVLPFRKIPSSDNLDSSLNLTVASPKSNLYYRYSSESPKYAKILDCPDEILQLIFSYCYDASYIEKLPFAFSYRKQRHTLIHDLPNTCLRFKKILSPRNVSFWKRLLKVHKKNPNSAVTCSESINTSAVAKFTDIPTIIPIFLDPSYQSYAAKTIHSDTSSLASSIIQTGDGTQSCDESTYIELACNLVGRCVLCNRIPKLTKFKDCITSFYRPSVATNICDQCLEAIIDFYEPVSRYKFDVMKDRLGVGYISRPGQKFPSWLSEHVQLARDEEKAFKSIYHSQGEFARSLFRLFRAQLAELCEQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
227 | Phosphorylation | ILSPRNVSFWKRLLK HCCCCCHHHHHHHHH | 29.01 | 28889911 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of POF14_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of POF14_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of POF14_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CUL1_SCHPO | cul1 | physical | 17016471 | |
SKP1_SCHPO | skp1 | physical | 17016471 | |
FDFT_SCHPO | erg9 | physical | 17016471 | |
EIF3A_SCHPO | tif32 | physical | 17016471 | |
MUG64_SCHPO | mug64 | physical | 17016471 | |
PMGY_SCHPO | gpm1 | physical | 17016471 | |
SPO4_SCHPO | spo4 | genetic | 22681890 | |
PAC2_SCHPO | pac2 | genetic | 22681890 | |
MED19_SCHPO | rox3 | genetic | 22681890 | |
UBC16_SCHPO | ubc16 | genetic | 22681890 | |
HMT2_SCHPO | hmt2 | genetic | 22681890 | |
GBB_SCHPO | git5 | genetic | 22681890 | |
MFM2_SCHPO | mfm2 | genetic | 22681890 | |
AATM_SCHPO | SPBC725.01 | genetic | 22681890 | |
CYB51_SCHPO | SPBC29A10.16c | genetic | 22681890 | |
SET1_SCHPO | set1 | genetic | 22681890 | |
VMS1_SCHPO | vms1 | genetic | 22681890 | |
MID1_SCHPO | mid1 | genetic | 22681890 | |
YQMA_SCHPO | SPCP1E11.10 | genetic | 22681890 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...