dbPTM

PMGY_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	PMGY_SCHPO
UniProt AC	P36623
Protein Name	Phosphoglycerate mutase
Gene Name	gpm1
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	211
Subcellular Localization
Protein Description
Protein Sequence	MTTEAAPNLLVLTRHGESEWNKLNLFTGWKDPALSETGIKEAKLGGERLKSRGYKFDIAFTSALQRAQKTCQIILEEVGEPNLETIKSEKLNERYYGDLQGLNKDDARKKWGAEQVQIWRRSYDIAPPNGESLKDTAERVLPYYKSTIVPHILKGEKVLIAAHGNSLRALIMDLEGLTGDQIVKRELATGVPIVYHLDKDGKYVSKELIDN

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MTTEAAPNL ------CCCCCCCCE	33.09	24763107
13	Phosphorylation	APNLLVLTRHGESEW CCCEEEEECCCCCCH	17.09	21712547
18	Phosphorylation	VLTRHGESEWNKLNL EEECCCCCCHHHCCC	53.13	21712547
35	Phosphorylation	GWKDPALSETGIKEA CCCCCCHHHHCCCCH	34.91	28889911
37	Phosphorylation	KDPALSETGIKEAKL CCCCHHHHCCCCHHH	40.61	28889911
61	Phosphorylation	YKFDIAFTSALQRAQ CCCCCHHHHHHHHHH	12.22	25720772
62	Phosphorylation	KFDIAFTSALQRAQK CCCCHHHHHHHHHHH	22.11	28889911
88	Phosphorylation	PNLETIKSEKLNERY CCHHHHHHHHHHHHH	35.79	28889911
95	Phosphorylation	SEKLNERYYGDLQGL HHHHHHHHHHCCCCC	12.96	28889911
96	Phosphorylation	EKLNERYYGDLQGLN HHHHHHHHHCCCCCC	15.47	28889911
122	Phosphorylation	QVQIWRRSYDIAPPN HHHHHHHHCCCCCCC	20.70	28889911
123	Phosphorylation	VQIWRRSYDIAPPNG HHHHHHHCCCCCCCC	15.01	25720772
136	Phosphorylation	NGESLKDTAERVLPY CCCCHHHHHHHHHHH	28.91	27738172
146	Phosphorylation	RVLPYYKSTIVPHIL HHHHHHHHHCHHHHH	13.77	21712547
147	Phosphorylation	VLPYYKSTIVPHILK HHHHHHHHCHHHHHC	23.11	24763107
166	Phosphorylation	LIAAHGNSLRALIMD EEEECCHHHHHHHHC	24.67	28889911
189	Phosphorylation	IVKRELATGVPIVYH HHHHHHCCCCCEEEE	51.87	25720772
203	Phosphorylation	HLDKDGKYVSKELID EECCCCCEEEHHHHC	18.58	25720772
205	Phosphorylation	DKDGKYVSKELIDN- CCCCCEEEHHHHCC-	19.81	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of PMGY_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of PMGY_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of PMGY_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of PMGY_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of PMGY_SCHPO

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of fission yeast."; Wilson-Grady J.T., Villen J., Gygi S.P.; J. Proteome Res. 7:1088-1097(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-37; SER-62; TYR-96 ANDSER-166, AND MASS SPECTROMETRY.	18257517 [Abstract]