UniProt ID | POF12_SCHPO | |
---|---|---|
UniProt AC | O60053 | |
Protein Name | F-box protein pof12 | |
Gene Name | pof12 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 440 | |
Subcellular Localization | Nucleus . | |
Protein Description | ||
Protein Sequence | MTTDVKAKNPASIFSHETLLHVLNDLSAHDLAALERVSRSWNSIVRRSSVWHNLYLSEFGTKHLRRHGRIEKKRRNWKGLFRRQSNWKDGRCKKVESMLPQLLNSEKSVGEDRLGLTLTHQNNIYFCNDVQISKWSSVGNSLKCQAISSFRDETVKSGPAVMCLDNASLYIGLKDGNLLHVTVHETGFGNIENLATFSTKFVALSSHKNYICGLTNDNNLYILQHSHQAGTKLKVLGKYHVSSIEKQVAIHFQQSKEGYEVVHVVFNDYVLSGGWTVSLQEFVFNEYCVKSSRLALHDNKDIEYSQQPASAIFMYGSYILTSHPDNSLILQRLYSTNNELRIKFLGRLLGHVCGVQISKLFSCGRIVSVSKNCADICVWDLHDTNYQSIVSPLMLTCTNIHNKPVSDYEKECKVQDIGLYEDTILITLSDGRILKFLFNI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of POF12_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of POF12_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of POF12_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of POF12_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SKP1_SCHPO | skp1 | physical | 19748355 | |
RYH1_SCHPO | ryh1 | genetic | 22681890 | |
YDO6_SCHPO | SPAC15A10.06 | genetic | 22681890 | |
SDH3_SCHPO | sdh3 | genetic | 22681890 | |
PAM17_SCHPO | pam17 | genetic | 22681890 | |
NEM1_SCHPO | nem1 | genetic | 22681890 | |
GBB_SCHPO | git5 | genetic | 22681890 | |
JHD1_SCHPO | epe1 | genetic | 22681890 | |
AROG_SCHPO | SPAP8A3.07c | genetic | 22681890 | |
SET1_SCHPO | set1 | genetic | 22681890 | |
EME1_SCHPO | eme1 | genetic | 22681890 | |
ASK1_SCHPO | ask1 | genetic | 22681890 | |
YFY7_SCHPO | SPAC9.07c | genetic | 22681890 | |
DPH5_SCHPO | dph5 | genetic | 22681890 | |
H2AZ_SCHPO | pht1 | genetic | 22681890 | |
YQMA_SCHPO | SPCP1E11.10 | genetic | 22681890 | |
POF12_SCHPO | pof12 | physical | 26771498 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...