dbPTM

POF8_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	POF8_SCHPO
UniProt AC	O13795
Protein Name	Protein pof8
Gene Name	pof8
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	402
Subcellular Localization	Cytoplasm . Nucleus .
Protein Description
Protein Sequence	MFVPRQLNVRKIKAFTGKENNSIADGNNNKLKDEHYKHNEASKEPSHSISGGLMLNQQDRQLIEPLNPDFLSAVDSILEIYFHRERQKEKVHLAFLIQQDDFWKGIRPNPTQNNLKYALSYVTNALFHFDNSSHMVIRNENIVLPLDIPLYDRIIYVEPVPATLSNKSLLLAGKLRKYLKEFLPYVDAIGTPEGYAFVILYKKVDQSALSKLPVPPGWVLLTRKEWTNREEKYFENQLHLVKASSSDVSNSSNSFPENRYPKLTKVEKQMTKSVSKTSQTDKDEDNLDFTKNLLTRIKNLHPLTNKSTIHSLLSYVFSRQTQNIACEPMYIDYRKDETEAIIRWKTPLHAETCINAFRTQERKQNSHDDIRAHRKKGSSRPFLIAELITGEEEKNYWRMLKK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of POF8_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of POF8_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of POF8_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of POF8_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
NSE6_SCHPO	nse6	genetic	18931302
RHP41_SCHPO	rhp41	genetic	18931302
SKP1_SCHPO	skp1	physical	19748355
TRX2_SCHPO	trx2	genetic	22681890
THP3_SCHPO	iss9	genetic	22681890
AATM_SCHPO	SPBC725.01	genetic	22681890
SET1_SCHPO	set1	genetic	22681890
SHR3_SCHPO	psh3	genetic	22681890
YQMA_SCHPO	SPCP1E11.10	genetic	22681890

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of POF8_SCHPO

Related Literatures of Post-Translational Modification