| UniProt ID | MED22_MOUSE | |
|---|---|---|
| UniProt AC | Q62276 | |
| Protein Name | Mediator of RNA polymerase II transcription subunit 22 | |
| Gene Name | Med22 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 200 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).. | |
| Protein Sequence | MAQQRALPQSKETLLQSYNKRLKDDIKSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAIDQRNQQLRALQEECDRKLITLRDEVSIDLYELEEEYYSSSSSLCEANDLPLCEAYWRLDLDADSADGLSAPLLASPETGAGPLQSAAPVHSHGGGPGPTEHT | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 38 | Ubiquitination | DNFTEIIKTAKIEDE HHHHHHHHHCCCCCC | 48.36 | 22790023 | |
| 83 | Ubiquitination | MKLVSDLKQFLILND HHHHHHHHHHHHHCC | 43.95 | - | |
| 173 | Phosphorylation | LSAPLLASPETGAGP CCCCEEECCCCCCCC | 24.20 | 26643407 | |
| 176 | Phosphorylation | PLLASPETGAGPLQS CEEECCCCCCCCCCC | 35.40 | 25293948 | |
| 183 | Phosphorylation | TGAGPLQSAAPVHSH CCCCCCCCCCCCCCC | 33.80 | 25293948 | |
| 189 | Phosphorylation | QSAAPVHSHGGGPGP CCCCCCCCCCCCCCC | 24.86 | 25293948 | |
| 197 | Phosphorylation | HGGGPGPTEHT---- CCCCCCCCCCC---- | 46.44 | 25293948 | |
| 200 | Phosphorylation | GPGPTEHT------- CCCCCCCC------- | 33.79 | 25293948 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MED22_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MED22_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MED22_MOUSE !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
