LAGE3_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: LAGE3_HUMAN
• UniProt AC: Q14657
• Protein Name: EKC/KEOPS complex subunit LAGE3 {ECO:0000305}
• Gene Name: LAGE3 {ECO:0000312|HGNC:HGNC:26058}
• Organism: Homo sapiens (Human).
• Sequence Length: 143
• Subcellular Localization: Cytoplasm . Nucleus .
• Protein Description: Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. LAGE3 functions as a dimerization module for the complex..
• Protein Sequence: MRDADADAGGGADGGDGRGGHSCRGGVDTAAAPAGGAPPAHAPGPGRDAASAARGSRMRPHIFTLSVPFPTPLEAEIAHGSLAPDAEPHQRVVGKDLTVSGRILVVRWKAEDCRLLRISVINFLDQLSLVVRTMQRFGPPVSR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Methylation	------MRDADADAG ------CCCCCCCCC	48.07	115481537
18	Methylation	GADGGDGRGGHSCRG CCCCCCCCCCCCCCC	53.30	115481525
24	Methylation	GRGGHSCRGGVDTAA CCCCCCCCCCCCCCC	48.17	115481533
95	Ubiquitination	PHQRVVGKDLTVSGR CCCCEECCCEEEECE	37.64	23000965
109	Ubiquitination	RILVVRWKAEDCRLL EEEEEEEEHHHCCEE	31.19	29901268
142	Phosphorylation	QRFGPPVSR------ HHHCCCCCC------	37.74	24719451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of LAGE3_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of LAGE3_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of LAGE3_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PRAME_HUMAN	PRAME	physical	22912744
CUL2_HUMAN	CUL2	physical	22912744
PRPK_HUMAN	TP53RK	physical	22912744
TPRKB_HUMAN	TPRKB	physical	22912744
OSGEP_HUMAN	OSGEP	physical	22912744
ELOC_HUMAN	TCEB1	physical	22912744
ELOB_HUMAN	TCEB2	physical	22912744
GON7_HUMAN	C14orf142	physical	22912744
MAGD2_HUMAN	MAGED2	physical	22939629
NDRG3_HUMAN	NDRG3	physical	22939629
PTMS_HUMAN	PTMS	physical	22939629
MCFD2_HUMAN	MCFD2	physical	22939629
PUM1_HUMAN	PUM1	physical	22939629
RN214_HUMAN	RNF214	physical	22939629
SAHH2_HUMAN	AHCYL1	physical	22939629
TM1L2_HUMAN	TOM1L2	physical	22939629
ANCHR_HUMAN	ZFYVE19	physical	22939629
SPS2_HUMAN	SEPHS2	physical	22939629
MT1A_HUMAN	MT1A	physical	22939629
OGFR_HUMAN	OGFR	physical	22939629
RAB5B_HUMAN	RAB5B	physical	22939629
RPAP1_HUMAN	RPAP1	physical	22939629
UBP34_HUMAN	USP34	physical	22939629
PLP2_HUMAN	PLP2	physical	22939629
PTN23_HUMAN	PTPN23	physical	22939629
RUXF_HUMAN	SNRPF	physical	22939629
SLD5_HUMAN	GINS4	physical	22939629
SSA27_HUMAN	SSSCA1	physical	22939629
RN114_HUMAN	RNF114	physical	22939629
CNN2_HUMAN	CNN2	physical	22863883
K1C40_HUMAN	KRT40	physical	25416956
CC28B_HUMAN	CCDC28B	physical	27173435

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.